KDFIINEQIRAREVRLIDQNGDQLGIKSKQEALEIAARRNLDLVLVAPNAKPPVCRIMDYGKFRFEQQKKEKEARK
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5me0:Y | 76 | 76 | 1.0000 | 1.0000 | 1.0000 | 2.25e-50 | 5me1:Y |
2 | 5lmn:X | 168 | 76 | 0.5921 | 0.2679 | 0.5921 | 1.75e-27 | 5lmo:X, 5lmp:X, 5lmq:X, 5lmr:X, 5lms:X, 5lmt:X, 5lmu:X, 5lmv:X |
3 | 8jsg:A | 167 | 61 | 0.5000 | 0.2275 | 0.6230 | 8.68e-21 | 8jsh:A, 5me0:Z, 5me1:Z |
4 | 3tnj:A | 130 | 56 | 0.1842 | 0.1077 | 0.2500 | 2.3 | |
5 | 1yum:A | 212 | 43 | 0.1711 | 0.0613 | 0.3023 | 3.0 | 1yum:B, 1yum:C, 1yum:D, 1yun:A, 1yun:B |
6 | 4v8l:D | 2822 | 31 | 0.1579 | 0.0043 | 0.3871 | 5.3 | 4ce4:o, 6hiv:US, 6hiv:UT, 6hiw:US, 6hiw:UT, 6hiy:US, 6hiy:UT, 4v8l:E, 4v8l:F, 4v8l:A, 4v8l:B, 4v8l:C, 4v8v:A, 4v8v:B, 4v8v:C, 4v8v:D, 4v8v:E, 4v8v:F, 4v8w:D, 4v8w:E, 4v8w:F, 4v8w:A, 4v8w:B, 4v8w:C |
7 | 2eer:B | 347 | 29 | 0.1447 | 0.0317 | 0.3793 | 6.0 | 2eer:A |
8 | 6eoa:A | 193 | 38 | 0.1711 | 0.0674 | 0.3421 | 6.4 |