KDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATYTTFKAGPILELEQWIDKYTSQLPPLT
AFILPSGGKISSALHFCRAVCCRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMK
The query sequence (length=152) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7rut:E | 187 | 156 | 0.9934 | 0.8075 | 0.9679 | 7.78e-109 | 6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C |
2 | 3ci1:A | 188 | 158 | 0.4013 | 0.3245 | 0.3861 | 1.65e-30 | 3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B |
3 | 3ke5:A | 182 | 145 | 0.3882 | 0.3242 | 0.4069 | 6.53e-26 | 3ke5:C, 3ke5:B |
4 | 2zhz:B | 174 | 153 | 0.3684 | 0.3218 | 0.3660 | 8.52e-25 | 2zhz:A, 2zhz:C |
5 | 8d32:A | 186 | 114 | 0.3092 | 0.2527 | 0.4123 | 4.76e-16 | 6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C |
6 | 8h0s:C | 190 | 131 | 0.2171 | 0.1737 | 0.2519 | 0.76 | 8h0s:A, 8h0t:A, 4poo:A |
7 | 8h0s:B | 171 | 76 | 0.1447 | 0.1287 | 0.2895 | 2.0 | 8h0s:D, 4poo:B |