KDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL
The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1om2:A | 95 | 66 | 1.0000 | 0.6947 | 1.0000 | 2.38e-42 | 3awr:A, 3ax2:A, 3ax2:C, 3ax5:C, 2v1s:D, 2v1s:E, 2v1t:A |
2 | 5az7:A | 434 | 66 | 0.9545 | 0.1452 | 0.9545 | 2.66e-26 | 3awr:B, 3ax2:E, 3ax2:G, 3ax3:A, 3ax3:G, 3ax3:C, 3ax3:E, 3ax5:A, 5az6:B, 5az6:A, 5az8:A, 2v1s:A, 2v1s:B, 2v1s:C, 2v1s:F, 2v1t:B |
3 | 7d5c:A | 919 | 53 | 0.1970 | 0.0141 | 0.2453 | 1.1 | |
4 | 8a0m:B | 964 | 35 | 0.1515 | 0.0104 | 0.2857 | 1.5 | |
5 | 8a0m:D | 975 | 35 | 0.1515 | 0.0103 | 0.2857 | 1.5 | |
6 | 8a0c:A | 1116 | 35 | 0.1515 | 0.0090 | 0.2857 | 1.6 | 8a0c:B, 8a0m:A, 8a0m:C |
7 | 6hiv:DA | 1557 | 57 | 0.2273 | 0.0096 | 0.2632 | 1.9 | 6hiw:DA, 7pub:DA |
8 | 6hiy:DA | 1426 | 57 | 0.2273 | 0.0105 | 0.2632 | 2.0 | |
9 | 4b3g:A | 614 | 54 | 0.2273 | 0.0244 | 0.2778 | 5.2 | 4b3g:B |
10 | 2jie:A | 445 | 53 | 0.2879 | 0.0427 | 0.3585 | 5.6 | 2o9r:A, 2o9t:A, 2z1s:A |
11 | 4pak:A | 304 | 52 | 0.2121 | 0.0461 | 0.2692 | 8.2 | 4p9k:A |
12 | 8jal:B | 573 | 27 | 0.1818 | 0.0209 | 0.4444 | 8.9 | 8jal:A, 8jaq:A, 8jaq:B, 8jaq:J, 8jaq:K, 8jar:A, 8jar:B, 8jas:A, 8jas:B, 8jas:K, 8jas:J, 8jau:A, 8jau:B, 8jav:A, 8jav:B, 8jav:J, 8jav:K |
13 | 6hxq:B | 410 | 24 | 0.1364 | 0.0220 | 0.3750 | 9.2 | |
14 | 7dnp:A | 174 | 34 | 0.1667 | 0.0632 | 0.3235 | 9.6 |