BioLiP

>protein
KCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQ
KLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR

The query sequence (length=124) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4ont:D	126	124	1.0000	0.9841	1.0000	2.15e-91	4ont:F, 4ont:E, 4zh1:D, 4zh1:E, 4zh1:F
2	4a5w:B	871	117	0.2742	0.0390	0.2906	0.049
3	4e0s:B	898	117	0.2742	0.0379	0.2906	0.050	7nyc:B, 7nyd:B
4	3t5o:A	871	117	0.2742	0.0390	0.2906	0.054
5	2uwn:A	187	103	0.2097	0.1390	0.2524	0.073	2v8e:A, 7zjm:B
6	2uwn:A	187	53	0.1452	0.0963	0.3396	4.0	2v8e:A, 7zjm:B
7	7aoe:B	1174	80	0.1694	0.0179	0.2625	0.24	7aoc:B, 7aod:B, 7aod:N
8	8am6:AAA	547	44	0.1371	0.0311	0.3864	0.25	8am3:AAA, 8am3:BBB, 8am6:BaB, 8am8:BBB, 8am8:AAA
9	7mwz:D	301	56	0.1452	0.0598	0.3214	0.26
10	4wqm:A	326	59	0.1532	0.0583	0.3220	0.47
11	2xwb:F	714	115	0.2742	0.0476	0.2957	1.8	3hrz:D, 3hs0:D, 3hs0:I, 7jtn:A, 7jtn:C, 7jtq:A, 7jtq:C, 7noz:F, 2ok5:A, 1q0p:A, 6qsw:AAA, 6qsw:BBB, 6qsw:CCC, 6qsx:AAA, 6qsx:BBB, 6rav:AAA, 6rav:BBB, 1rrk:A, 1rs0:A, 1rtk:A, 6rur:L, 6rur:J, 6ruv:J, 6ruv:L, 6t8u:AAA, 6t8u:BBB, 6t8u:CCC, 6t8v:AAA, 6t8v:BBB, 6t8w:AAA, 6t8w:BBB, 2win:I, 2win:J, 2win:K, 2win:L, 2xwb:H
12	7aih:U	92	65	0.1694	0.2283	0.3231	1.9	7ane:U
13	1ckl:A	126	26	0.0887	0.0873	0.4231	2.3	1ckl:B, 1ckl:D, 1ckl:E, 1ckl:F, 2o39:C, 2o39:D
14	7rzw:B	864	33	0.0887	0.0127	0.3333	2.3	7rzw:A
15	3mse:B	168	33	0.0887	0.0655	0.3333	4.0
16	6yxx:E9	200	54	0.1532	0.0950	0.3519	4.6
17	2jrp:A	81	27	0.0887	0.1358	0.4074	4.9
18	6nbe:N	186	40	0.0968	0.0645	0.3000	6.0	6nas:N, 6nbw:N

[Back]