KAVTFYEDINYGGASVSLQPGNYTLSQLNTAKIPNDWMSSLKVPSGWTVDVYENDNFTGTKWTYTSDTPWVGNDANDKMT
SVKIYS
The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3so1:H | 89 | 86 | 0.9884 | 0.9551 | 0.9884 | 2.40e-58 | 5ht8:A, 3i9h:A, 3i9h:B, 3i9h:C, 3i9h:D, 3i9h:E, 3i9h:F, 3i9h:G, 3i9h:H, 3iaj:A, 3sny:A, 3snz:A, 3so0:A, 3so0:B, 3so0:C, 3so0:D, 3so0:E, 3so0:F, 3so0:G, 3so1:A, 3so1:B, 3so1:C, 3so1:D, 3so1:E, 3so1:F, 3so1:G |
2 | 3hzb:D | 90 | 85 | 0.3488 | 0.3333 | 0.3529 | 5.14e-15 | 3hzb:A, 3hzb:B, 3hzb:C, 3hzb:E, 3hzb:F, 3hzb:G, 3hzb:H |
3 | 1prr:A | 173 | 84 | 0.3256 | 0.1618 | 0.3333 | 1.86e-11 | 1nps:A, 1prs:A |
4 | 1prr:A | 173 | 84 | 0.3605 | 0.1792 | 0.3690 | 1.53e-10 | 1nps:A, 1prs:A |
5 | 2k1w:A | 85 | 38 | 0.2093 | 0.2118 | 0.4737 | 4.39e-05 | 5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D |
6 | 2k1w:A | 85 | 38 | 0.2093 | 0.2118 | 0.4737 | 0.003 | 5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D |
7 | 6sli:A | 482 | 53 | 0.2326 | 0.0415 | 0.3774 | 0.97 | 5cx8:A, 5cx8:B, 6sli:C, 6sli:F, 6sli:I, 6slj:D, 6slj:C, 6sln:C, 6sln:D, 6sm3:A, 6smq:A |
8 | 4iok:A | 557 | 53 | 0.1860 | 0.0287 | 0.3019 | 2.4 | 1fp7:A, 1fpm:A, 1fpm:B, 4iok:B, 4iol:A, 4iol:B, 4jjz:A, 4jjz:B, 4jki:A, 3qus:A, 3qus:B |
9 | 8g27:I | 720 | 24 | 0.0930 | 0.0111 | 0.3333 | 4.1 | 8g27:C, 8g27:D, 8g2j:C, 8g2j:D, 8g2j:I, 6wlb:A, 6wlb:C, 6wlb:B |
10 | 5znh:A | 314 | 46 | 0.1512 | 0.0414 | 0.2826 | 4.7 | 5zsx:A, 5zsz:A |
11 | 5nmx:D | 409 | 38 | 0.1395 | 0.0293 | 0.3158 | 5.4 | 5nmw:A, 5nmw:B, 5nmw:C, 5nmw:D, 5nmx:A, 5nmx:B, 5nmx:C |
12 | 6s6z:A | 1083 | 57 | 0.1628 | 0.0129 | 0.2456 | 6.1 | 6s6z:D, 6s6z:B, 6s6z:H, 6s6z:F, 6s6z:G, 6s6z:E, 6s6z:C, 6sd0:A, 6sd0:B, 6sd0:C, 6sd0:D |
13 | 1l9y:A | 263 | 39 | 0.1163 | 0.0380 | 0.2564 | 6.5 | 1jt1:A, 1k07:A, 1k07:B, 1l9y:B, 5w90:A, 5wck:A, 5wck:B |