KAVTFYEDINYGGASVSLQPGNYTLSQLNTAKIPNDDMTSLKVPSGWTVDVYENDNFTGTKWTYTSDTPWVGNDANDKMT
SVKIYST
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 3so1:H | 89 | 87 | 0.9655 | 0.9438 | 0.9655 | 8.87e-57 | 5ht8:A, 3i9h:A, 3i9h:B, 3i9h:C, 3i9h:D, 3i9h:E, 3i9h:F, 3i9h:G, 3i9h:H, 3iaj:A, 3sny:A, 3snz:A, 3so0:A, 3so0:B, 3so0:C, 3so0:D, 3so0:E, 3so0:F, 3so0:G, 3so1:A, 3so1:B, 3so1:C, 3so1:D, 3so1:E, 3so1:F, 3so1:G |
| 2 | 3hzb:D | 90 | 85 | 0.3448 | 0.3333 | 0.3529 | 5.59e-16 | 3hzb:A, 3hzb:B, 3hzb:C, 3hzb:E, 3hzb:F, 3hzb:G, 3hzb:H |
| 3 | 1prr:A | 173 | 85 | 0.3103 | 0.1561 | 0.3176 | 5.08e-11 | 1nps:A, 1prs:A |
| 4 | 1prr:A | 173 | 84 | 0.3448 | 0.1734 | 0.3571 | 5.08e-10 | 1nps:A, 1prs:A |
| 5 | 2k1w:A | 85 | 38 | 0.2069 | 0.2118 | 0.4737 | 6.65e-05 | 5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D |
| 6 | 2k1w:A | 85 | 38 | 0.1954 | 0.2000 | 0.4474 | 0.002 | 5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D |
| 7 | 4iok:A | 557 | 53 | 0.2069 | 0.0323 | 0.3396 | 0.036 | 1fp7:A, 1fpm:A, 1fpm:B, 4iok:B, 4iol:A, 4iol:B, 4jjz:A, 4jjz:B, 4jki:A, 3qus:A, 3qus:B |
| 8 | 6sli:A | 482 | 53 | 0.2414 | 0.0436 | 0.3962 | 0.046 | 5cx8:A, 5cx8:B, 6sli:C, 6sli:F, 6sli:I, 6slj:D, 6slj:C, 6sln:C, 6sln:D, 6sm3:A, 6smq:A |
| 9 | 7b1s:B | 466 | 38 | 0.1494 | 0.0279 | 0.3421 | 0.72 | 7b1s:E, 7b2c:B, 7b2c:E |
| 10 | 7xzo:C | 561 | 53 | 0.1724 | 0.0267 | 0.2830 | 1.2 | 7xzo:A, 7xzo:B, 7xzo:D, 7xzp:A, 7xzp:B |
| 11 | 5znh:A | 314 | 46 | 0.1494 | 0.0414 | 0.2826 | 3.1 | 5zsx:A, 5zsz:A |
| 12 | 8g27:I | 720 | 24 | 0.0920 | 0.0111 | 0.3333 | 3.1 | 8g27:C, 8g27:D, 8g2j:C, 8g2j:D, 8g2j:I, 6wlb:A, 6wlb:C, 6wlb:B |
| 13 | 6fiy:B | 303 | 32 | 0.1149 | 0.0330 | 0.3125 | 3.7 | 6fiy:A, 6fks:A, 6fks:B, 6fkt:A, 6fkt:B, 6fl2:A, 6fl2:B, 6rpd:A, 6rpd:B, 6rpe:A, 6rpe:B, 6rqy:A, 6rqy:B, 6rr1:A, 6rr1:B, 6rr4:A, 6rr4:B, 6rr5:A, 6rr5:B, 6rr6:A, 6rr6:B, 6rr8:A, 6rr8:B |
| 14 | 5nmx:D | 409 | 38 | 0.1379 | 0.0293 | 0.3158 | 5.6 | 5nmw:A, 5nmw:B, 5nmw:C, 5nmw:D, 5nmx:A, 5nmx:B, 5nmx:C |
| 15 | 6s6z:A | 1083 | 47 | 0.1264 | 0.0102 | 0.2340 | 5.6 | 6s6z:D, 6s6z:B, 6s6z:H, 6s6z:F, 6s6z:G, 6s6z:E, 6s6z:C, 6sd0:A, 6sd0:B, 6sd0:C, 6sd0:D |
| 16 | 3hpv:A | 297 | 49 | 0.1379 | 0.0404 | 0.2449 | 7.8 | 3hpv:B, 3hpv:C, 3hpv:D, 3hpy:A, 3hpy:B, 3hpy:C, 3hpy:D, 3hq0:A, 3hq0:B, 3hq0:C, 3hq0:D |
umich.edu