KAVSLGTSKINYIDPRIICSWAKAQDVPINKIFSATIQKKFPWAMNAENFDF
The query sequence (length=52) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2b9s:B | 52 | 52 | 1.0000 | 1.0000 | 1.0000 | 1.59e-33 | |
2 | 1sc7:A | 567 | 52 | 0.4808 | 0.0441 | 0.4808 | 8.75e-13 | 1a31:A, 1a36:A, 1ej9:A, 1k4t:A, 1lpq:A, 1nh3:A, 1r49:A, 1rrj:A, 1seu:A, 1t8i:A, 1tl8:A |
3 | 1rr8:C | 494 | 52 | 0.4808 | 0.0506 | 0.4808 | 1.07e-12 | 1a35:A, 1k4s:A |
4 | 4n20:A | 639 | 23 | 0.1923 | 0.0156 | 0.4348 | 2.0 | 4n25:A, 4n2d:A, 4n2f:A, 4n2h:A, 4n2k:A |
5 | 4n2i:A | 662 | 23 | 0.1923 | 0.0151 | 0.4348 | 2.2 | 4n22:A, 4n24:A, 4n26:A, 4n28:A, 4n2a:A, 4n2b:A, 4n2c:A, 4n2e:A, 4n2g:A, 4n2l:A, 4n2m:A, 4n2n:A |
6 | 3j16:A | 386 | 32 | 0.1923 | 0.0259 | 0.3125 | 2.6 | 5m1j:A1 |
7 | 3i4k:A | 370 | 34 | 0.1731 | 0.0243 | 0.2647 | 3.4 | 3i4k:B, 3i4k:C, 3i4k:D, 3i4k:E, 3i4k:F, 3i4k:G, 3i4k:H |
8 | 3q94:A | 285 | 11 | 0.1923 | 0.0351 | 0.9091 | 4.1 | 3q94:B |
9 | 4jv3:A | 407 | 38 | 0.3077 | 0.0393 | 0.4211 | 4.2 | 3mqd:A, 3u0e:A, 3u0f:A |
10 | 3c9f:B | 540 | 49 | 0.2692 | 0.0259 | 0.2857 | 5.1 | 3c9f:A |
11 | 1e1c:A | 727 | 24 | 0.1154 | 0.0083 | 0.2500 | 5.3 | 1e1c:C, 1req:A, 1req:C, 2req:A, 2req:C, 3req:A, 4req:A, 4req:C, 5req:A, 5req:C, 6req:A, 6req:C, 7req:A, 7req:C |