KASHIRIANRKRVEMFVAKRFHLPTRLATAAPDIAAEWHDELNPMHMYPAIIGIGHVQPVWWKCAICSHSYQMSVEKRVV
RGGGCPQCVVNGKRAV
The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6sga:Fd | 96 | 96 | 1.0000 | 1.0000 | 1.0000 | 4.45e-69 | 7pua:Fd, 6sgb:Fd |
2 | 6yxx:E2 | 369 | 64 | 0.2292 | 0.0596 | 0.3438 | 2.75e-04 | |
3 | 6yxx:E2 | 369 | 82 | 0.2083 | 0.0542 | 0.2439 | 1.3 | |
4 | 8gyj:B | 428 | 53 | 0.1979 | 0.0444 | 0.3585 | 0.050 | 8gyi:A, 8gyi:B, 8gyj:A |
5 | 7aor:at | 242 | 29 | 0.1250 | 0.0496 | 0.4138 | 0.11 | |
6 | 7aor:at | 242 | 72 | 0.1979 | 0.0785 | 0.2639 | 0.30 | |
7 | 7ane:at | 204 | 29 | 0.1146 | 0.0539 | 0.3793 | 0.16 | |
8 | 7pub:DS | 243 | 29 | 0.1146 | 0.0453 | 0.3793 | 0.24 | 6hiv:DS, 6hiw:DS, 6hiy:DS |
9 | 1gn9:A | 543 | 29 | 0.1146 | 0.0203 | 0.3793 | 1.9 | 1gn9:B, 1gnl:A, 1gnl:B, 1oa0:A, 1oa0:B, 1upx:A, 1upx:B |
10 | 7qh2:C | 467 | 80 | 0.2396 | 0.0493 | 0.2875 | 2.4 | 7qh2:F |
11 | 1v2a:B | 209 | 29 | 0.1250 | 0.0574 | 0.4138 | 3.8 | 1v2a:A, 1v2a:C, 1v2a:D |
12 | 5xyi:K | 90 | 48 | 0.1562 | 0.1667 | 0.3125 | 4.2 | |
13 | 1lbg:A | 357 | 28 | 0.1042 | 0.0280 | 0.3571 | 4.6 | 2bjc:A, 2bjc:B, 1cjg:A, 1cjg:B, 1efa:A, 1efa:B, 1efa:C, 1jwl:B, 1jwl:A, 1jwl:C, 2kei:A, 2kei:B, 2kej:A, 2kej:B, 2kek:A, 2kek:B, 1l1m:A, 1l1m:B, 1lbg:D, 1lbh:A, 1lbh:B, 1lbh:C, 1lbh:D, 1lcc:A, 1lcd:A, 1osl:A, 1osl:B, 2p9h:A, 2p9h:B, 2paf:A, 2paf:B, 2pe5:A, 2pe5:B, 2pe5:C, 4rzt:A, 4rzt:B, 4rzt:C, 4rzt:D, 1tlf:A, 1tlf:B, 1tlf:C, 1tlf:D |
14 | 4iz9:A | 381 | 36 | 0.1562 | 0.0394 | 0.4167 | 6.1 | |
15 | 6iq5:A | 459 | 17 | 0.0938 | 0.0196 | 0.5294 | 6.2 | 3pm0:A |
16 | 7w1y:4 | 653 | 36 | 0.0833 | 0.0123 | 0.2222 | 6.6 | 7w1y:C, 6xtx:4, 6xty:4 |
17 | 6oyu:B | 459 | 17 | 0.0938 | 0.0196 | 0.5294 | 6.6 | 6oyu:A, 6oyv:A, 6oyv:B |
18 | 8b9d:4 | 677 | 36 | 0.0833 | 0.0118 | 0.2222 | 6.7 | 7pfo:4, 7plo:4 |
19 | 6iq5:B | 437 | 17 | 0.0938 | 0.0206 | 0.5294 | 6.8 | |
20 | 8i9p:Ce | 194 | 46 | 0.1146 | 0.0567 | 0.2391 | 7.3 | 8i9r:Ce, 8i9t:Ce, 8i9v:Ce |
21 | 6mpx:A | 673 | 50 | 0.1458 | 0.0208 | 0.2800 | 9.0 | 1t61:C, 1t61:F |
22 | 6mpx:A | 673 | 50 | 0.1458 | 0.0208 | 0.2800 | 9.0 | 1t61:C, 1t61:F |
23 | 7nc5:A | 239 | 19 | 0.0938 | 0.0377 | 0.4737 | 9.6 | 7nc5:B, 7nc5:C, 7nc5:D, 7nc5:E, 7nc5:F, 7nc6:A, 7nc6:B, 7nc6:C, 7nc6:D, 7nc6:E, 7nc6:F, 7ncu:A, 7ncu:B |