KAMINLHIQKDNPKIVHAFDGEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIK
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ew0:A | 77 | 63 | 0.9841 | 0.8052 | 0.9841 | 1.12e-42 | 6de9:A, 3ew0:B, 4ezf:A, 4ezf:B, 4f1e:A, 4f1e:B, 4f1e:C, 4f1e:D, 4f1e:E, 4f1e:F, 4f1e:G, 4f1e:H, 4f1e:I, 4f1e:J, 4f1e:K, 4f1e:L, 4f1e:M, 4f1e:N, 4f1e:O, 4f1e:P, 4f1e:Q, 4f1e:R, 4f28:A, 4f28:B, 4f2c:A, 4f2c:B, 3lpq:A, 3lpq:B, 7p0o:A, 7p0o:B, 2qd0:A, 2qd0:B, 2qh7:A, 2qh7:B, 2r13:A, 3ree:A |
2 | 3fnv:B | 68 | 63 | 0.6825 | 0.6324 | 0.6825 | 6.06e-28 | 3fnv:A, 4oo7:A, 4oo7:B, 4ooa:A, 4ooa:B, 4ooa:C, 4ooa:D, 4ooa:E, 4ooa:F, 7p0p:A, 7p0p:B, 7p0p:C, 7p0p:D |
3 | 7yvz:A | 63 | 62 | 0.6032 | 0.6032 | 0.6129 | 5.30e-25 | |
4 | 3s2r:B | 78 | 61 | 0.4762 | 0.3846 | 0.4918 | 4.19e-16 | 3s2q:A, 3s2q:B, 3s2r:A |
5 | 3tbn:A | 87 | 17 | 0.1746 | 0.1264 | 0.6471 | 0.040 | |
6 | 3tbn:A | 87 | 24 | 0.1746 | 0.1264 | 0.4583 | 1.1 | |
7 | 3tbm:A | 61 | 22 | 0.1746 | 0.1803 | 0.5000 | 0.092 | 3tbm:B |
8 | 6avj:A | 92 | 21 | 0.1905 | 0.1304 | 0.5714 | 0.23 | 6avj:B, 6avj:C |
9 | 3tbo:A | 54 | 22 | 0.1905 | 0.2222 | 0.5455 | 0.39 | |
10 | 5tbd:G | 112 | 33 | 0.2063 | 0.1161 | 0.3939 | 1.4 | 5tbd:F, 5tbd:B, 5tbd:K |
11 | 6z1p:AV | 129 | 31 | 0.1905 | 0.0930 | 0.3871 | 1.5 | |
12 | 2xn2:A | 729 | 60 | 0.2540 | 0.0219 | 0.2667 | 5.8 | |
13 | 7bkb:B | 296 | 35 | 0.1429 | 0.0304 | 0.2571 | 7.9 | 7bkb:b, 7bkc:B, 7bkc:b, 7bkd:B, 7bkd:b, 7bke:B, 7bke:b |
14 | 1is3:A | 134 | 12 | 0.1429 | 0.0672 | 0.7500 | 8.9 | 1is4:A, 1wld:A, 1wlw:A |