BioLiP

>protein
KALFKPADVILDPKTANPILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCS
KNVQRKGWVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSFSEA
LYPVFRILTLEPTALTICPAL

The query sequence (length=181) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ixv:A	187	180	0.9945	0.9626	1.0000	4.68e-136	8ize:A, 8izg:A, 6j06:A, 6j06:C, 6j06:B, 8jyc:C, 8jyc:D, 8jye:C, 8jye:D, 4n7u:A, 5zxk:A
2	6j0k:A	191	179	0.8729	0.8272	0.8827	6.23e-119	6j0g:A, 6j0g:B, 6j0g:C, 6j0g:D, 6j0k:B
3	8jya:B	191	180	0.7901	0.7487	0.7944	1.42e-109	8hjt:C, 8hjt:D, 8jy9:A, 8jy9:B, 8jyf:B
4	8hjt:A	197	179	0.5249	0.4822	0.5307	1.46e-60	8hjt:B
5	8igt:A	208	183	0.5083	0.4423	0.5027	1.58e-55	8jyc:A, 8jyc:B, 8jye:A, 8jye:B
6	8pd6:A	181	169	0.4641	0.4641	0.4970	1.58e-51
7	4cg4:C	376	176	0.4475	0.2154	0.4602	2.11e-50	4cg4:D, 4cg4:E, 4cg4:F
8	7ovx:A	174	172	0.3978	0.4138	0.4186	4.13e-39	8a5l:A, 8a5m:A, 8a5m:B, 8a8x:A, 8a8x:C, 7ow2:A, 7ow2:B, 7ow2:C, 7ow2:D, 8r5b:A, 8r5b:B, 8r5c:A, 7w0q:A, 7w0s:B, 7w0s:C, 7w0s:E, 7w0t:F, 7w0t:B, 7w0t:C, 7x6y:A, 7x6z:A, 7x70:A
9	7xyz:B	456	170	0.2928	0.1162	0.3118	1.94e-23	7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D
10	7xt2:B	388	170	0.2873	0.1340	0.3059	6.99e-23	7xt2:A
11	4b3n:A	557	162	0.2873	0.0934	0.3210	2.01e-18	4b3n:B
12	3v97:A	667	41	0.0773	0.0210	0.3415	3.9	3v8v:A
13	5ul4:A	729	67	0.0939	0.0233	0.2537	5.2	5ul3:A
14	3muo:A	684	27	0.0718	0.0190	0.4815	5.3	3iuq:A, 3iur:A, 3ivm:A
15	2y5p:A	72	69	0.1160	0.2917	0.3043	6.1	2y5p:B
16	8eg3:A	554	48	0.0829	0.0271	0.3125	7.1	1p49:A
17	5lj5:O	283	68	0.1050	0.0671	0.2794	9.4

[Back]