KAKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEV
VVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGII
LVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
The query sequence (length=228) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4o7n:A | 233 | 228 | 1.0000 | 0.9785 | 1.0000 | 1.36e-164 | 4o7l:A, 4o7r:A, 4o7s:A, 4o7t:A, 4o7v:A, 4o7w:A, 4o7y:A, 4o7z:A, 4o81:A, 4o81:B, 4o82:A, 4o82:B, 4o83:A, 4o83:B, 4o84:A, 4o84:B, 4o86:A, 3u54:A, 3u54:B |
2 | 3nua:B | 237 | 223 | 0.5132 | 0.4937 | 0.5247 | 1.24e-75 | 3nua:A |
3 | 2z02:A | 242 | 222 | 0.5219 | 0.4917 | 0.5360 | 1.47e-75 | 2yzl:A, 2z02:B |
4 | 2ywv:A | 237 | 226 | 0.5088 | 0.4895 | 0.5133 | 5.32e-72 | 2ywv:B |
5 | 4fe2:B | 235 | 223 | 0.4605 | 0.4468 | 0.4709 | 7.14e-62 | 4fe2:A, 4fgr:A, 4fgr:B, 4nye:A, 4nye:B |
6 | 2gqr:A | 237 | 223 | 0.4167 | 0.4008 | 0.4260 | 4.64e-55 | 2gqr:B, 2gqs:A, 2gqs:B |
7 | 7ale:A | 419 | 200 | 0.2982 | 0.1623 | 0.3400 | 8.27e-26 | 7ale:B, 6yb8:A, 6yb8:B, 6yb9:A, 6yb9:B |
8 | 1obg:A | 305 | 248 | 0.3246 | 0.2426 | 0.2984 | 9.18e-21 | 2cnq:A, 2cnu:A, 2cnv:A, 1obd:A |
9 | 6yx3:A | 297 | 275 | 0.3421 | 0.2626 | 0.2836 | 1.61e-19 | 6yy6:A, 6yy7:A, 6yy8:A, 6yy9:A, 6yya:A, 6yyb:A, 6yyc:A, 6yyd:A, 6z0q:A, 6z0r:A |
10 | 3l2n:A | 376 | 96 | 0.1009 | 0.0612 | 0.2396 | 0.46 | 3l2n:B |
11 | 8i9r:Cg | 233 | 58 | 0.0789 | 0.0773 | 0.3103 | 1.1 | 8i9t:Cg |
12 | 1ynp:B | 298 | 100 | 0.1316 | 0.1007 | 0.3000 | 1.7 | 1ynp:A, 1ynq:A, 1ynq:B |
13 | 7d80:5 | 432 | 27 | 0.0526 | 0.0278 | 0.4444 | 2.3 | 7d6z:h, 1w2b:5 |
14 | 5lu4:A | 850 | 28 | 0.0570 | 0.0153 | 0.4643 | 3.2 | 5lu4:B |
15 | 5jvl:A | 874 | 28 | 0.0570 | 0.0149 | 0.4643 | 3.2 | 5jvj:A, 5jvl:C, 5jvl:D, 5jvn:A |
16 | 3l76:A | 585 | 59 | 0.0702 | 0.0274 | 0.2712 | 4.5 | 3l76:B |
17 | 5th5:A | 241 | 79 | 0.0833 | 0.0788 | 0.2405 | 4.8 | 5tgs:A, 5tgs:B, 5th5:B, 5th5:C, 5th5:D |
18 | 4ewv:B | 492 | 69 | 0.0746 | 0.0346 | 0.2464 | 7.0 | 4ewv:A |
19 | 4epm:A | 554 | 69 | 0.0746 | 0.0307 | 0.2464 | 7.2 | 4eq4:A, 4eq4:B, 4eql:A, 4eql:B, 4l39:A, 4l39:B, 6oms:A, 6oms:B |
20 | 9bh5:Cd | 105 | 50 | 0.0702 | 0.1524 | 0.3200 | 7.8 | 9cai:Cd |
21 | 4pet:A | 329 | 55 | 0.0833 | 0.0578 | 0.3455 | 8.1 | 4pet:B |
22 | 4prl:A | 330 | 85 | 0.0965 | 0.0667 | 0.2588 | 8.5 | 4prl:B |