BioLiP

>protein
IYTKNGDKGQTRIIQILYKNDPRVAAYGEVNELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPRHSFKFKQ
EQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARY
ANYLEQQPDMLYR

The query sequence (length=173) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ci1:A	188	179	0.9942	0.9149	0.9609	4.29e-125	3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B
2	3ke5:A	182	175	0.4740	0.4505	0.4686	3.80e-47	3ke5:C, 3ke5:B
3	7rut:E	187	174	0.3988	0.3690	0.3966	8.18e-37	6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C
4	2zhz:B	174	174	0.3699	0.3678	0.3678	1.04e-28	2zhz:A, 2zhz:C
5	8d32:A	186	182	0.3931	0.3656	0.3736	4.37e-26	6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C
6	2eix:A	243	59	0.0867	0.0617	0.2542	0.38	2eix:B
7	4ybh:A	302	49	0.0867	0.0497	0.3061	4.4	4p2y:A
8	7dbe:B	332	66	0.1040	0.0542	0.2727	6.0	7dbe:A, 7dbe:C, 7dbe:D, 7wud:B, 7wud:A, 7wud:C, 7wud:D
9	6ndl:A	323	84	0.1387	0.0743	0.2857	7.5	6apw:A, 6aqq:A, 4dq2:A, 8eni:A, 4ha8:A, 6oru:A, 3rir:A, 3rkw:A, 3rky:A, 3v7c:A, 3v7r:A, 3v7s:A, 3v8k:A, 3v8l:A
10	8u3k:E	669	112	0.1387	0.0359	0.2143	8.7	8u0j:A
11	9ezy:B	657	112	0.1387	0.0365	0.2143	9.1

[Back]