IYTKNGDKGQTRIIGKILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADHSFKF
KQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITKRAERQIVQLMREEQINQDVLIFINRLSDYFFAAA
RYANYLEQQPDMLYR
The query sequence (length=175) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ci1:A | 188 | 179 | 0.9943 | 0.9255 | 0.9721 | 1.95e-127 | 3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B |
2 | 3ke5:A | 182 | 176 | 0.4743 | 0.4560 | 0.4716 | 1.44e-48 | 3ke5:C, 3ke5:B |
3 | 7rut:E | 187 | 175 | 0.4057 | 0.3797 | 0.4057 | 3.45e-39 | 6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C |
4 | 2zhz:B | 174 | 175 | 0.3657 | 0.3678 | 0.3657 | 6.66e-29 | 2zhz:A, 2zhz:C |
5 | 8d32:A | 186 | 182 | 0.3943 | 0.3710 | 0.3791 | 4.76e-25 | 6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C |
6 | 2eix:A | 243 | 59 | 0.0914 | 0.0658 | 0.2712 | 0.24 | 2eix:B |
7 | 1jq5:A | 366 | 151 | 0.2343 | 0.1120 | 0.2715 | 2.7 | 1jpu:A, 1jqa:A |
8 | 3o8o:B | 763 | 85 | 0.1143 | 0.0262 | 0.2353 | 6.1 | 3o8o:D, 3o8o:F, 3o8o:H |