BioLiP

>protein
IYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKL
YLQKFRE

The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4awl:B	92	87	1.0000	0.9457	1.0000	2.25e-61	7ah8:A, 7ah8:C, 6qmp:B, 6qmq:B, 6qms:B, 8qu2:B, 8qu3:B, 8qu4:B
2	7aw7:B	92	86	0.7586	0.7174	0.7674	1.40e-47	7aw9:B, 4g91:B, 4g92:B, 6y35:B, 6y36:B, 6y37:B, 6y39:B, 6y39:E, 6y39:H
3	6r2v:B	93	86	0.7126	0.6667	0.7209	6.80e-46	7cvo:B, 7cvq:B, 7cvq:G, 7cvq:L, 7cvq:Q
4	7c9o:B	85	82	0.6437	0.6588	0.6829	2.60e-40
5	1jfi:B	135	84	0.3678	0.2370	0.3810	2.47e-16
6	4wzs:B	113	74	0.3103	0.2389	0.3649	2.28e-10
7	1a7w:A	68	64	0.2644	0.3382	0.3594	2.52e-05	5t5k:A, 5t5k:B, 5t5k:C, 5t5k:D, 5t5k:E, 5t5k:F
8	7aw9:C	118	65	0.2299	0.1695	0.3077	0.016	7aw7:C, 4g91:C, 4g92:C, 6y35:C, 6y36:C, 6y37:C, 6y39:C, 6y39:F, 6y39:I
9	6qmq:C	84	72	0.2414	0.2500	0.2917	0.12	7ah8:B, 7ah8:D, 4awl:C, 6qmp:C, 6qms:C, 8qu2:C, 8qu3:C, 8qu4:C
10	6so9:A	112	35	0.1609	0.1250	0.4000	1.9
11	1yfr:A	448	77	0.2299	0.0446	0.2597	2.2	1yfr:B, 1yfs:A, 1yfs:B, 1ygb:A
12	7d69:B	78	54	0.1149	0.1282	0.1852	3.3	7d69:F
13	7d69:D	96	41	0.1609	0.1458	0.3415	3.7	7d69:H
14	8je1:A	675	56	0.1379	0.0178	0.2143	5.0
15	8sq0:A	1402	38	0.1724	0.0107	0.3947	5.6	8sq0:B, 8sql:A, 8sqm:A
16	6kxv:E	95	67	0.1839	0.1684	0.2388	5.6	6kxv:A
17	7vax:F	471	80	0.2184	0.0403	0.2375	8.2	3a5c:E, 8gxw:E, 8gxx:E, 6r0w:E, 6r0y:D, 6r10:F, 7val:E, 7van:E, 7vap:E, 7vaq:E, 7var:E, 7vas:E, 7vat:E, 7vav:E, 7vaw:E, 7vay:E, 7vb0:E, 3w3a:E, 3w3a:M
18	7vfs:A	1266	45	0.1149	0.0079	0.2222	8.9	7vfu:A, 7vfv:A, 7vfw:A

[Back]