BioLiP

>protein
IVYGDYNNDGNVDALDFAGLKKYIMAAYVKNLDVNLDNEVNSTDLAILKKYLLGMV

The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2vn6:B	64	59	0.9286	0.8125	0.8814	2.34e-28	2vn5:B, 2vn5:D
2	1daq:A	71	56	0.4643	0.3662	0.4643	7.89e-11	1dav:A, 2mte:A
3	4fl4:A	68	61	0.4464	0.3676	0.4098	1.34e-09	4fl4:D, 4fl4:G, 4fl4:J
4	3ul4:B	63	61	0.4643	0.4127	0.4262	1.62e-05
5	5nrk:B	68	61	0.3750	0.3088	0.3443	1.73e-05	5nrk:D, 5nrm:B
6	5nrk:B	68	30	0.1964	0.1618	0.3667	1.2	5nrk:D, 5nrm:B
7	2ccl:B	62	62	0.3036	0.2742	0.2742	3.01e-04	2ccl:D, 1ohz:B
8	4dh2:B	72	63	0.4286	0.3333	0.3810	5.38e-04	4dh2:D
9	8x3a:A	151	56	0.4107	0.1523	0.4107	0.001	8x39:A, 8x39:B
10	8x3a:A	151	61	0.3036	0.1126	0.2787	3.4	8x39:A, 8x39:B
11	5lxv:B	65	57	0.3393	0.2923	0.3333	0.001	5lxv:D
12	6kg9:A	67	56	0.3393	0.2836	0.3393	0.035	6kgc:B, 6kgd:B, 6kge:D, 6kge:B, 6kgf:D, 6kgf:B
13	2ozn:B	131	50	0.2500	0.1069	0.2800	0.16
14	6s7o:A	656	30	0.1786	0.0152	0.3333	0.66	6ftg:5, 6fti:5, 6ftj:5, 8pn9:A
15	4fl4:I	309	54	0.2857	0.0518	0.2963	0.90	2b59:B, 4fl4:C, 4fl4:F, 4fl4:L, 5g5d:B, 3kcp:A
16	3bq5:A	709	37	0.2143	0.0169	0.3243	1.7
17	1t7l:A	734	37	0.2143	0.0163	0.3243	1.7	3bq5:B, 3bq6:A, 3bq6:B, 1t7l:B, 1xdj:A, 1xdj:B, 1xpg:A, 1xpg:B, 1xr2:A, 1xr2:B
18	2y3n:B	60	49	0.3036	0.2833	0.3469	2.7
19	6rb7:A	305	33	0.2143	0.0393	0.3636	2.9	6rb7:B, 6rb7:E, 6rb7:F, 6rd1:A, 6rd1:B
20	5m0y:B	157	25	0.1786	0.0637	0.4000	4.8	5k39:B
21	7yca:3	227	20	0.1786	0.0441	0.5000	5.7
22	1sl6:A	168	16	0.1429	0.0476	0.5000	6.2	1k9j:A, 1sl6:B, 1sl6:C, 1sl6:D, 1sl6:E, 1sl6:F, 1xph:A
23	7d18:A	293	24	0.1429	0.0273	0.3333	6.7
24	5n5p:B	87	20	0.1786	0.1149	0.5000	7.2	5n5p:D

[Back]