BioLiP

>protein
IVYGDYNNDGNVDALDFAGLKKYIMAAYVKNLDVNLDNEVNSTDLAILKKYLLGM

The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2vn6:B	64	58	0.9273	0.7969	0.8793	7.68e-28	2vn5:B, 2vn5:D
2	1daq:A	71	56	0.4727	0.3662	0.4643	7.41e-11	1dav:A, 2mte:A
3	4fl4:A	68	58	0.4545	0.3676	0.4310	2.62e-09	4fl4:D, 4fl4:G, 4fl4:J
4	3ul4:B	63	60	0.4727	0.4127	0.4333	3.89e-05
5	5nrk:B	68	60	0.3818	0.3088	0.3500	4.49e-05	5nrk:D, 5nrm:B
6	5nrk:B	68	30	0.2000	0.1618	0.3667	1.1	5nrk:D, 5nrm:B
7	2ccl:B	62	59	0.3091	0.2742	0.2881	4.33e-04	2ccl:D, 1ohz:B
8	8x3a:A	151	56	0.4182	0.1523	0.4107	8.25e-04	8x39:A, 8x39:B
9	8x3a:A	151	59	0.3091	0.1126	0.2881	6.1	8x39:A, 8x39:B
10	4dh2:B	72	62	0.4364	0.3333	0.3871	0.001	4dh2:D
11	5lxv:B	65	57	0.3455	0.2923	0.3333	0.001	5lxv:D
12	6kg9:A	67	56	0.3455	0.2836	0.3393	0.027	6kgc:B, 6kgd:B, 6kge:D, 6kge:B, 6kgf:D, 6kgf:B
13	2ozn:B	131	50	0.2545	0.1069	0.2800	0.14
14	6s7o:A	656	30	0.1818	0.0152	0.3333	0.60	6ftg:5, 6fti:5, 6ftj:5, 8pn9:A
15	4fl4:I	309	54	0.2909	0.0518	0.2963	0.81	2b59:B, 4fl4:C, 4fl4:F, 4fl4:L, 5g5d:B, 3kcp:A
16	2y3n:B	60	49	0.3091	0.2833	0.3469	2.7
17	6rb7:A	305	33	0.2182	0.0393	0.3636	2.8	6rb7:B, 6rb7:E, 6rb7:F, 6rd1:A, 6rd1:B
18	5m0y:B	157	25	0.1818	0.0637	0.4000	4.2	5k39:B
19	3bq5:A	709	35	0.2000	0.0155	0.3143	4.3
20	1t7l:A	734	35	0.2000	0.0150	0.3143	4.3	3bq5:B, 3bq6:A, 3bq6:B, 1t7l:B, 1xdj:A, 1xdj:B, 1xpg:A, 1xpg:B, 1xr2:A, 1xr2:B
21	7yca:3	227	20	0.1818	0.0441	0.5000	5.8
22	5n5p:B	87	20	0.1818	0.1149	0.5000	6.4	5n5p:D
23	7d18:A	293	24	0.1455	0.0273	0.3333	7.4

[Back]