IVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSNKTFVTMMGRFLQAYLQSFA
EVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQV
AFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIV
FQCCNPVYGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF
The query sequence (length=314) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2waz:X | 315 | 314 | 0.9968 | 0.9937 | 0.9968 | 0.0 | 1anv:A, 2wb0:X |
2 | 1adu:A | 287 | 311 | 0.9140 | 1.0000 | 0.9228 | 0.0 | 1adu:B, 1adv:A, 1adv:B |
3 | 8d8j:d | 660 | 90 | 0.0828 | 0.0394 | 0.2889 | 2.1 | 8d8k:d |
4 | 7r5s:W | 88 | 30 | 0.0414 | 0.1477 | 0.4333 | 3.4 | 7ywx:W |