IVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQSNGNYKFDQMLLTAQ
NLPASYNYCRLVSRSLTVRSSTLPLNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDL
GYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQSGGVTITLFSANIDAITSLSIGGELVFHTSVHGL
ALDATIYLIGFDGTTVITRAVASDNGLTTGIDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSASGSLAV
TIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERERLGIKTVWP
TREYTDFREYFMEVA
The query sequence (length=415) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2gsy:E | 433 | 420 | 0.9735 | 0.9330 | 0.9619 | 0.0 | 2df7:A, 2df7:F, 2df7:B, 2df7:C, 2df7:E, 2df7:L, 2df7:G, 2df7:K, 2df7:M, 2df7:H, 2df7:N, 2df7:O, 2df7:I, 2df7:J, 2df7:Q, 2df7:P, 2df7:R, 2df7:S, 2df7:T, 2gsy:A, 2gsy:B, 2gsy:C, 2gsy:J, 2gsy:D, 2gsy:F, 2gsy:I, 2gsy:K, 2gsy:G, 2gsy:H, 2gsy:N, 2gsy:L, 2gsy:M, 2gsy:R, 2gsy:O, 2gsy:P, 2gsy:Q, 2gsy:S, 2gsy:T |
2 | 3pzc:B | 276 | 54 | 0.0410 | 0.0616 | 0.3148 | 0.90 | 3mey:B, 3mf1:B |
3 | 4gyj:A | 618 | 72 | 0.0554 | 0.0372 | 0.3194 | 1.2 | 3bmx:A, 3bmx:B, 4gyj:B, 4gyk:A, 3nvd:A, 3nvd:B |
4 | 7rk5:B | 501 | 82 | 0.0482 | 0.0399 | 0.2439 | 3.4 | 7rk5:A |
5 | 5jrk:A | 695 | 78 | 0.0458 | 0.0273 | 0.2436 | 3.5 | 5jrk:B |
6 | 2cb3:C | 173 | 85 | 0.0554 | 0.1329 | 0.2706 | 4.3 | 2cb3:A, 2cb3:B, 2cb3:D |