BioLiP

>protein
IVPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNYFTYTGSGGSSDQKLTN
NNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERSGFLVWRYLLRRDDTE
PEPWTREGKDRTRQLGLTMQYPEGYLEALANKEKSR

The query sequence (length=196) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2zkd:A	210	197	0.9337	0.8714	0.9289	2.01e-132	3f8i:A, 3f8i:B, 3f8j:B, 3fde:A, 3fde:B, 6m2v:B, 6m2v:A, 2zkd:B, 2zke:A, 2zkf:A, 2zo0:B, 2zo1:B, 2zo2:B
2	3clz:B	210	203	0.8469	0.7905	0.8177	9.45e-120	3clz:A, 3clz:C, 3clz:D, 8jig:A, 8jig:B, 6vcs:A, 6vcs:B, 6vcs:E
3	4pw7:E	198	195	0.7245	0.7172	0.7282	5.20e-101	4pw5:A, 4pw5:B, 4pw5:E, 4pw5:F, 4pw6:A, 4pw6:B, 4pw7:A, 4pw7:B, 4pw7:F
4	4ygi:A	150	172	0.3214	0.4200	0.3663	3.43e-22	3q0b:X, 3q0c:X, 3q0c:A, 3q0d:X, 3q0d:A, 3q0f:A, 3q0f:X
5	6a5n:A	502	175	0.3112	0.1215	0.3486	1.03e-21
6	6a5m:A	488	175	0.3265	0.1311	0.3657	1.28e-20	6a5k:A
7	6ghs:A	285	135	0.2806	0.1930	0.4074	1.82e-20
8	4qen:A	472	182	0.3061	0.1271	0.3297	9.30e-17	4qeo:A, 4qep:A
9	4nj5:A	482	196	0.2755	0.1120	0.2755	1.10e-07
10	5mg5:L	396	32	0.0714	0.0354	0.4375	0.84	5mg5:C, 5mg5:O, 5mg5:R
11	5zmm:D	489	35	0.0714	0.0286	0.4000	3.0
12	5zmm:A	530	35	0.0714	0.0264	0.4000	3.5	5zmm:B, 5zmm:C, 5zmm:E, 5zmm:F, 5zmn:A, 5zmo:A
13	8uu6:W	102	46	0.0765	0.1471	0.3261	4.7	8a57:X, 8a5i:X, 8a63:X, 7nhn:X, 8uu4:W, 8uu5:W, 8uu7:W, 8uu8:W, 8uu9:W, 8uua:W
14	6gy5:A	285	41	0.0612	0.0421	0.2927	7.3
15	1lck:A	164	35	0.0612	0.0732	0.3429	9.5	1bhf:A, 1cwd:L, 1cwe:A, 1cwe:C, 1fbz:A, 1fbz:B, 2iim:A, 1ijr:A, 1lcj:A, 1lkk:A, 1lkl:A, 1x27:A, 1x27:B, 1x27:C, 1x27:D, 1x27:E, 1x27:F

[Back]