BioLiP

>protein
ITTPIARGLLRVGLTPDVVTILGTTASVAGALTLFPMGKLFAGACVVWFFVLFDMLDGAMARERGGGTRFGAVLDATCDR
ISDGAVFCGLLWWIAFHMRDRPLVIATLICLVTSQVISYIKARAEASGLRGDGGFIERPERLIIVLTGAGVSDFPFVPWP
PALSVGMWLLAVASVITCVQRLHTVWTSPGAIDRMA

The query sequence (length=196) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6h5a:B	209	196	1.0000	0.9378	1.0000	1.34e-138	6h59:A, 6h59:B, 6h5a:A
2	6wm5:A	337	195	0.8571	0.4985	0.8615	2.98e-117	6wm5:C, 6wmv:A, 6wmv:C
3	5d92:D	342	191	0.4082	0.2339	0.4188	3.38e-34	5d91:A, 5d92:A, 5d92:B, 5d92:C
4	7pow:B	204	47	0.0918	0.0882	0.3830	0.002	7b1k:A, 7b1k:B, 7b1l:A, 7b1l:B, 7b1n:A, 7b1n:B, 7pow:A
5	8gyw:B	380	79	0.0969	0.0500	0.2405	0.004	8gyw:A, 8gyx:B, 8gyx:A
6	4o6m:B	341	87	0.1327	0.0762	0.2989	0.007	4o6m:A, 4o6n:A, 4o6n:B, 4q7c:A, 4q7c:B
7	7ouf:E	278	50	0.0816	0.0576	0.3200	0.16	7ouf:B, 7oug:E, 7oug:B, 7ouh:E, 7ouh:B, 7pel:B, 7pel:E
8	7rhq:A	974	109	0.1480	0.0298	0.2661	0.18	7rhr:A
9	8ero:A	364	79	0.1020	0.0549	0.2532	0.53	8ero:B, 8erp:B, 8erp:A
10	7ouf:A	258	46	0.0765	0.0581	0.3261	1.1	7ouf:D, 7oug:D, 7oug:A, 7ouh:D, 7ouh:A, 7pel:D, 7pel:A
11	6rmg:A	1026	88	0.1173	0.0224	0.2614	3.6	6dmb:A, 6dmy:A, 7k65:A, 6mg8:A, 6n7g:A, 6n7g:B, 6n7g:D, 6n7g:E, 6n7h:A, 6n7h:B, 6n7k:A, 6n7k:B, 6n7k:D, 6n7k:E, 6rtw:A, 6rvd:A, 6rvd:B, 7v6y:A, 7v6z:A
12	6voy:A	276	50	0.0612	0.0435	0.2400	6.9	6voy:C, 6voy:B, 6voy:D

[Back]