ITTPIARGLLRVGLTPDVVTILGTTASVAGALTLFPMGKLFAGACVVWFFVLFDMLDGAMARERGGGTRFGAVLDATCDR
ISDGAVFCGLLWWIAFHMRDRPLVIATLICLVTSQVISYIKARAEASGLRGDGGFIERPERLIIVLTGAGVSDFPFVPWP
PALSVGMWLLAVASVITCVQRLHTVWTSPGAIDRMA
The query sequence (length=196) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6h5a:B | 209 | 196 | 1.0000 | 0.9378 | 1.0000 | 1.34e-138 | 6h59:A, 6h59:B, 6h5a:A |
2 | 6wm5:A | 337 | 195 | 0.8571 | 0.4985 | 0.8615 | 2.98e-117 | 6wm5:C, 6wmv:A, 6wmv:C |
3 | 5d92:D | 342 | 191 | 0.4082 | 0.2339 | 0.4188 | 3.38e-34 | 5d91:A, 5d92:A, 5d92:B, 5d92:C |
4 | 7pow:B | 204 | 47 | 0.0918 | 0.0882 | 0.3830 | 0.002 | 7b1k:A, 7b1k:B, 7b1l:A, 7b1l:B, 7b1n:A, 7b1n:B, 7pow:A |
5 | 8gyw:B | 380 | 79 | 0.0969 | 0.0500 | 0.2405 | 0.004 | 8gyw:A, 8gyx:B, 8gyx:A |
6 | 4o6m:B | 341 | 87 | 0.1327 | 0.0762 | 0.2989 | 0.007 | 4o6m:A, 4o6n:A, 4o6n:B, 4q7c:A, 4q7c:B |
7 | 7ouf:E | 278 | 50 | 0.0816 | 0.0576 | 0.3200 | 0.16 | 7ouf:B, 7oug:E, 7oug:B, 7ouh:E, 7ouh:B, 7pel:B, 7pel:E |
8 | 7rhq:A | 974 | 109 | 0.1480 | 0.0298 | 0.2661 | 0.18 | 7rhr:A |
9 | 8ero:A | 364 | 79 | 0.1020 | 0.0549 | 0.2532 | 0.53 | 8ero:B, 8erp:B, 8erp:A |
10 | 7ouf:A | 258 | 46 | 0.0765 | 0.0581 | 0.3261 | 1.1 | 7ouf:D, 7oug:D, 7oug:A, 7ouh:D, 7ouh:A, 7pel:D, 7pel:A |
11 | 6rmg:A | 1026 | 88 | 0.1173 | 0.0224 | 0.2614 | 3.6 | 6dmb:A, 6dmy:A, 7k65:A, 6mg8:A, 6n7g:A, 6n7g:B, 6n7g:D, 6n7g:E, 6n7h:A, 6n7h:B, 6n7k:A, 6n7k:B, 6n7k:D, 6n7k:E, 6rtw:A, 6rvd:A, 6rvd:B, 7v6y:A, 7v6z:A |
12 | 6voy:A | 276 | 50 | 0.0612 | 0.0435 | 0.2400 | 6.9 | 6voy:C, 6voy:B, 6voy:D |