ITNLRMKAKAQQLTWECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVSTWILFPENSGKPWAGAENLTCWIHDVDFL
SCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFV
VFSQIEILTPPQMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYE
FLSAWSTPQRFEC
The query sequence (length=253) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5uwc:G | 253 | 253 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 6h41:A | 309 | 216 | 0.2530 | 0.2071 | 0.2963 | 3.98e-11 | 3qt2:B |
3 | 1eba:A | 212 | 206 | 0.2095 | 0.2500 | 0.2573 | 0.025 | 1eba:B, 1ebp:A, 1ebp:B |
4 | 2gys:B | 406 | 269 | 0.2688 | 0.1675 | 0.2528 | 0.079 | |
5 | 4ld7:A | 397 | 45 | 0.0553 | 0.0353 | 0.3111 | 1.1 | 4ld7:B, 4ld7:C, 4ld7:D, 4ld7:E, 4ld7:F, 4ld7:G, 4ld7:H, 4ld7:I, 4ld7:J, 4ld7:K, 4ld7:L, 4ld7:M, 4ld7:N, 4ld7:O, 4ld7:P |
6 | 5hca:A | 266 | 43 | 0.0474 | 0.0451 | 0.2791 | 7.4 | 5hca:C, 5hca:B, 5hcb:A, 5hcb:B |
7 | 3l1e:A | 105 | 31 | 0.0395 | 0.0952 | 0.3226 | 9.3 |