BioLiP

>protein
ISACPKCGMTFQQFRKIGRFGCSECYKTFHSNITPILRKVHSGNTVHAGKIPKRIGGNLHVRRQIDMLKKELESLIHQEE
FENAAHVRDQIRLLEQSLK

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8wtc:B	100	99	1.0000	0.9900	1.0000	4.37e-71	8wtb:B, 8wtb:D, 8wtc:D
2	8gqd:E	59	49	0.2222	0.3729	0.4490	5.20e-12
3	5fks:A	731	35	0.1414	0.0192	0.4000	0.34
4	7odf:A	703	32	0.1010	0.0142	0.3125	0.41
5	5b4x:B	479	59	0.1919	0.0397	0.3220	0.55	3a7q:B, 5b4x:D, 5b4y:B
6	4ayg:A	1028	46	0.1515	0.0146	0.3261	1.2	4ayg:B, 3hz3:A, 3klk:A, 3kll:A
7	8uw3:A	1265	51	0.1818	0.0142	0.3529	2.1	7n8s:A, 7n94:A, 7n94:B, 8sp5:A, 8sp5:B, 8sp7:A, 8sxt:A, 8sxu:A, 1vyb:B
8	8av6:J	647	38	0.1414	0.0216	0.3684	2.5	8oo7:J, 8oop:J
9	7drc:C	906	41	0.1515	0.0166	0.3659	2.6	7drb:C, 7drb:D, 7w3v:C, 7w3x:C
10	7rbx:C	425	39	0.1313	0.0306	0.3333	3.1	7rbx:A, 7rbx:B, 7rbx:D
11	6lt4:A	623	39	0.1212	0.0193	0.3077	3.9	6lt4:B, 6lt4:C, 6lt4:D, 6lt4:E, 6lt4:F, 6lt4:G, 6lt4:H, 6lt4:I, 6lt4:J, 6lt4:K, 6lt4:L, 6lt4:M, 6lt4:N
12	2i13:A	151	60	0.1616	0.1060	0.2667	5.0
13	5z8l:A	204	22	0.1010	0.0490	0.4545	6.3	5z8n:A, 5z8n:B, 5z8n:C
14	3u44:A	1122	21	0.0909	0.0080	0.4286	7.0	3u4q:A
15	4cej:A	1177	21	0.0909	0.0076	0.4286	7.6	4ceh:A, 4cei:A
16	6ra9:B	458	49	0.1414	0.0306	0.2857	7.9	8b6z:A, 4c0s:A, 4c0s:B, 8g5z:EF, 8g60:EF, 8g6j:EF, 5lzs:jj, 6ra9:A, 6zmo:CD
17	9asj:A	741	33	0.1212	0.0162	0.3636	8.1	9asj:B, 9bp9:A, 9bp9:C, 9bpa:A, 9bpa:C, 9bpa:E, 9bpa:G

[Back]