IRWLAAPTSWSWVEQANAHPMEVLIDHAHCERKAAGAAVQMMFRYLCEPGLGEALSPLAREELEHFEQVLALIKARGRYL
EPLPSPGYGADLARQIRKGEPQRMLDSFLVAGLIEARSHERMALLAEHSPDPQLRELYSDLLASEARHFGLYWVLCEQRY
PRELIVERLEVLALAEVKALEGALTRPEDVRMHSCGVDVTQ
The query sequence (length=201) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ux1:C | 202 | 200 | 0.9950 | 0.9901 | 1.0000 | 1.27e-145 | 5ux1:A, 5ux1:B, 5ux1:D |
2 | 8fhb:A | 204 | 199 | 0.7264 | 0.7157 | 0.7337 | 1.26e-99 | |
3 | 8fhc:B | 215 | 198 | 0.3980 | 0.3721 | 0.4040 | 1.67e-34 | 8fhc:A |
4 | 6zmb:C | 200 | 192 | 0.3731 | 0.3750 | 0.3906 | 1.53e-33 | 8afj:B, 8afj:A, 2itb:A, 2itb:B, 6zma:B, 6zma:C, 6zmb:B, 6zmc:B, 6zmc:C |
5 | 6cfw:J | 143 | 50 | 0.0896 | 0.1259 | 0.3600 | 0.29 | |
6 | 6u8y:J | 177 | 51 | 0.0746 | 0.0847 | 0.2941 | 0.47 | 6u8y:j |
7 | 1og6:C | 298 | 162 | 0.1990 | 0.1342 | 0.2469 | 1.3 | 1og6:A, 1og6:B |
8 | 5gsn:A | 445 | 81 | 0.1095 | 0.0494 | 0.2716 | 1.4 | 5gsn:B, 5gsn:C, 5gsn:D, 5ipy:A, 5ipy:B, 5iq1:A, 5iq1:B, 5iq4:A, 5iq4:B |
9 | 5z5c:B | 336 | 34 | 0.0597 | 0.0357 | 0.3529 | 3.1 | 5b53:A, 5b55:A, 5b55:B, 5z5c:A, 5z5c:C, 5z5c:D |
10 | 7twz:A | 298 | 85 | 0.1095 | 0.0738 | 0.2588 | 5.4 | 7twz:B, 7twz:C, 7twz:D, 7twz:E, 7twz:F |
11 | 4mz0:A | 896 | 120 | 0.1443 | 0.0324 | 0.2417 | 5.6 | |
12 | 2ply:A | 212 | 84 | 0.1294 | 0.1226 | 0.3095 | 6.7 | 2ply:B, 2uwm:A, 2uwm:B, 1wsu:A, 1wsu:B, 1wsu:C |
13 | 6v85:A | 1901 | 57 | 0.0846 | 0.0089 | 0.2982 | 6.8 | 6v86:A |
14 | 3hrr:A | 317 | 62 | 0.0945 | 0.0599 | 0.3065 | 9.6 | 3hrr:B, 5kbz:A, 5kbz:B |
15 | 9boh:A | 402 | 80 | 0.1244 | 0.0622 | 0.3125 | 9.9 | 9boh:B, 9bow:A, 9bow:B, 9bpe:A, 9bpe:B, 2dkj:A, 2dkj:B, 8ssy:A, 8ssy:B, 8sui:B |