IRVKVFSNDLDKALTILQKKMQSSGMERLIKGTQTHHIKNSEKKVLARKNLERRIKSIDFARKLQS
The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6xyw:Bs | 66 | 66 | 1.0000 | 1.0000 | 1.0000 | 2.83e-42 | |
2 | 4ztx:A | 768 | 46 | 0.2727 | 0.0234 | 0.3913 | 0.037 | |
3 | 8qaw:A | 185 | 36 | 0.1970 | 0.0703 | 0.3611 | 4.3 | 7oj5:A, 7oj5:B, 7oj5:C, 7oj5:D, 7oj5:E, 7oj5:F, 7oj5:G, 7oj5:H, 7oj5:I, 7oj5:J, 7oj5:K, 7oj5:L, 7oj5:M, 7oj5:N, 7oj5:O, 7oj5:P, 7oj5:Q, 7oj5:R, 7oj5:S, 7oj5:T, 7oj5:V, 7oj5:W, 7oj5:X, 7oj5:Y, 8qav:A, 8qav:S, 8qav:W, 8qav:B, 8qav:N, 8qav:R, 8qav:C, 8qav:Q, 8qav:V, 8qav:D, 8qav:H, 8qav:X, 8qav:E, 8qav:O, 8qav:Y, 8qav:F, 8qav:P, 8qav:G, 8qav:J, 8qav:M, 8qav:T, 8qav:I, 8qav:K, 8qav:L, 8qaw:B, 8qaw:C, 8qaw:D, 8qaw:E, 8qaw:F, 8qaw:G, 8qaw:H, 8qax:A, 8qax:B, 8qax:C, 8qax:D, 8qax:E, 8qax:F, 8qay:A, 8qay:B, 8qay:C, 8qay:D, 8qay:E, 8qay:F, 8qay:G, 8qay:H |
4 | 8osi:A | 400 | 15 | 0.1515 | 0.0250 | 0.6667 | 6.1 | |
5 | 7poa:A | 398 | 38 | 0.2424 | 0.0402 | 0.4211 | 7.6 | 7poa:B, 7pob:A, 7pob:D, 7pob:B, 7pob:C, 7poc:A, 7poc:D, 7poc:B, 7poc:C |
6 | 1s5j:A | 727 | 40 | 0.1667 | 0.0151 | 0.2750 | 7.9 | |
7 | 1zlk:A | 65 | 28 | 0.1515 | 0.1538 | 0.3571 | 8.2 | 1zlk:B |