IRCFITPDISKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFP
The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1lxg:A | 71 | 66 | 1.0000 | 0.9155 | 0.9848 | 2.35e-41 | 1lxh:A, 7pc0:K, 6zfm:A, 6zfm:B, 6zfm:D, 6zfm:E |
| 2 | 8vy8:B | 75 | 61 | 0.5385 | 0.4667 | 0.5738 | 1.99e-18 | 1abt:A, 2btx:A, 1bxp:A, 1haa:A, 1haj:A, 5hbv:A, 1hc9:A, 1hc9:B, 1hoy:A, 1idg:A, 1idh:A, 1jbd:A, 1kc4:A, 1kl8:A, 1l4w:A, 1ljz:A, 2qc1:A, 1rgj:A, 6uwz:G, 8vy8:A, 8vy8:E, 8vy8:G |
| 3 | 1v6p:A | 62 | 44 | 0.3385 | 0.3548 | 0.5000 | 2.82e-07 | 1v6p:B |
| 4 | 5ebx:A | 62 | 57 | 0.3538 | 0.3710 | 0.4035 | 1.48e-06 | 6ebx:B |
| 5 | 9avv:G | 62 | 44 | 0.3231 | 0.3387 | 0.4773 | 5.60e-06 | 9avv:F, 9awk:F, 9awk:G |
| 6 | 5mg9:A | 65 | 56 | 0.3385 | 0.3385 | 0.3929 | 0.005 | |
| 7 | 2bhi:A | 60 | 59 | 0.3385 | 0.3667 | 0.3729 | 0.028 | 2bhi:B, 1h0j:A, 1h0j:B, 1h0j:C, 1xt3:A |
| 8 | 7c28:A | 65 | 54 | 0.2769 | 0.2769 | 0.3333 | 0.12 | 7c28:B |
| 9 | 1woj:A | 209 | 24 | 0.1846 | 0.0574 | 0.5000 | 1.1 | |
| 10 | 8q7h:A | 1403 | 26 | 0.1692 | 0.0078 | 0.4231 | 2.5 | |
| 11 | 2ydc:A | 217 | 18 | 0.1538 | 0.0461 | 0.5556 | 5.2 | 4wcc:A, 4wda:A, 4wdb:A, 4wdf:A, 4wdg:A, 4wfr:A, 2ydb:A, 2ydd:A, 2yoz:A, 2yp0:A, 2ypc:A, 2ype:A, 2yph:A, 2yq9:A, 3zbr:A, 3zbr:B, 3zbs:A, 3zbz:A |
| 12 | 2bne:B | 238 | 42 | 0.1692 | 0.0462 | 0.2619 | 6.6 | 2bnd:A, 2bnd:B, 2bne:A, 2bnf:A, 2bnf:B, 2v4y:A, 2v4y:E, 2v4y:F, 2v4y:B, 2v4y:D, 2v4y:C |
| 13 | 4aw2:A | 398 | 22 | 0.1538 | 0.0251 | 0.4545 | 8.8 |
umich.edu