BioLiP

>protein
IQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEI
VDT

The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3kik:A	94	84	1.0000	0.8830	0.9881	6.56e-54	4c31:B, 4c31:E, 3kik:B, 3kik:D, 3kik:C, 3kjl:A, 3kjl:B, 3kjl:C, 3kjl:D, 4mbe:F, 4mbe:C
2	1xpl:A	389	69	0.2289	0.0488	0.2754	0.14	1txt:A, 1txt:B, 1txt:C, 1txt:D, 1xpk:A, 1xpk:B, 1xpk:C, 1xpk:D, 1xpl:B, 1xpl:C, 1xpl:D, 1xpm:A, 1xpm:B, 1xpm:C, 1xpm:D
3	8twu:A	403	81	0.2289	0.0471	0.2346	0.69	8hny:A, 8hnz:A, 8ho0:A, 8ho1:A, 7s3j:A, 7s3j:B, 7s3t:A, 6vxv:A, 6vza:A, 6vzb:A, 6w0s:A, 6w0s:B, 6xai:A, 6xai:B, 6xaj:A, 6xak:A, 6xak:B, 6xal:A, 6xam:A
4	7mq8:NH	1066	46	0.1807	0.0141	0.3261	0.90	7mqa:NH
5	5hyh:A	287	45	0.1566	0.0453	0.2889	2.7	5hyg:A
6	5e3x:A	489	32	0.1446	0.0245	0.3750	3.1
7	4e0u:A	408	66	0.2651	0.0539	0.3333	3.8	4e0u:B, 7xvj:A, 7xvj:B, 7xvj:C, 7xvj:D, 7y3v:A, 7y3v:B, 7y3v:C, 7y3v:D
8	5j6f:A	352	32	0.1205	0.0284	0.3125	5.6	5j6f:B
9	4b7f:A	515	42	0.1325	0.0214	0.2619	5.7	4b7f:B, 4b7f:C, 4b7f:D, 4b7g:A, 4b7g:B, 4b7g:C, 4b7g:D, 4b7h:A, 4b7h:B, 4b7h:C, 4b7h:D
10	2a81:A	235	36	0.1325	0.0468	0.3056	6.3
11	7zel:A	827	76	0.2048	0.0206	0.2237	6.6	7zel:B, 7zep:B, 7zes:A, 7zes:B
12	6y3z:P	348	72	0.2289	0.0546	0.2639	8.4
13	8pv1:LB	389	75	0.2771	0.0591	0.3067	8.9	7olc:LB, 7old:LB, 8oo0:LB, 8pv2:LB, 8pv3:LB, 8pv4:LB, 8pv5:LB, 8pv6:LB, 8pv7:LB, 8pv8:LB, 8pvk:LB, 8pvl:LB, 7r81:E1, 7z3n:LB, 7z3o:LB
14	6j72:A	561	48	0.1687	0.0250	0.2917	9.1

[Back]