BioLiP

>protein
IQLGVTRNKIMTAQYECYQKIMQDPIEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRH
PASNRTWTNYTQCN

The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4rwf:A	555	97	1.0000	0.1694	0.9691	8.71e-65	6v2e:A, 2xvt:C, 2xvt:F
2	6zho:A	577	96	0.9574	0.1560	0.9375	1.21e-61	8ax5:A, 8ax6:A, 8ax7:A, 6d1u:A, 6d1u:B, 6d1u:C, 3n7r:A, 3n7r:C, 3n7r:D, 3n7r:B, 3n7s:A, 3n7s:C, 3n7s:D, 3n7s:B, 7p0f:A, 7p0i:A, 4rwg:A, 4rwg:B, 4rwg:C, 5v6y:A, 5v6y:B, 5v6y:C, 5v6y:D, 6zis:A
3	7knu:R	341	93	0.8936	0.2463	0.9032	1.36e-58
4	7tyn:R	373	93	0.6489	0.1635	0.6559	6.93e-44	9auc:R, 8f0j:R, 8f0k:R, 8f2b:R, 6niy:R, 7tyf:R, 7tyo:R, 7tyw:R, 7tyx:R, 7tyy:R, 7tzf:R
5	6pfo:A	474	93	0.6489	0.1287	0.6559	8.58e-43	5ii0:A, 5ii0:B, 5ii0:C, 6pfo:B, 6pgq:A
6	6fj3:A	562	84	0.3404	0.0569	0.3810	2.22e-14	8d51:A, 8d52:A, 7uzo:A, 7uzp:A, 7uzp:C, 7uzp:E
7	6nbh:R	379	81	0.3191	0.0792	0.3704	9.25e-14	8flt:R, 8ha0:R, 8haf:R, 8jr9:R, 6nbf:R, 6nbi:R
8	3l2j:A	484	81	0.3191	0.0620	0.3704	1.71e-13	3c4m:A, 3c4m:B, 3h3g:A, 3l2j:B
9	7f16:R	376	85	0.2872	0.0718	0.3176	7.04e-10
10	7vvo:R	302	40	0.1915	0.0596	0.4500	4.18e-09	8gw8:R
11	5yqz:R	558	81	0.2766	0.0466	0.3210	3.43e-07	5xez:A, 5xf1:A
12	7dur:R	371	95	0.2766	0.0701	0.2737	4.77e-07	7lll:R, 7lly:R
13	5xez:B	499	81	0.2766	0.0521	0.3210	5.76e-07	5xf1:B
14	6whc:R	371	81	0.2766	0.0701	0.3210	6.91e-07	8jru:R, 8wg8:R
15	2xdg:A	89	56	0.1915	0.2022	0.3214	2.12e-05	2xdg:B
16	7lci:R	393	97	0.2660	0.0636	0.2577	2.23e-05	7c2e:R, 7duq:R, 7e14:R, 7evm:R, 7fim:R, 8jip:R, 8jir:R, 8jis:R, 7lcj:R, 7lck:R, 5nx2:A, 6orv:RP, 7s15:R, 7s1m:R, 7vbh:R, 7vbi:R, 6vcb:R, 6x19:R, 6x1a:R, 7x8r:R, 7x8s:R, 6xox:R
17	7fin:R	380	82	0.2234	0.0553	0.2561	8.45e-05	7dty:R, 7fiy:R, 7rbt:R, 7vab:R, 8yw4:R
18	6wpw:R	398	81	0.2660	0.0628	0.3086	8.75e-05	8fu6:R, 8jiq:R, 8jit:R, 8jiu:R, 6lmk:R, 6lml:R, 7v35:R
19	6ln2:A	437	78	0.2340	0.0503	0.2821	1.01e-04	3c59:A, 3c5t:A, 3iol:A, 5otu:A, 5otu:C, 5otv:C, 5otv:A, 5otw:C, 5otw:A, 5otx:A, 5otx:C, 4zgm:A
20	3n96:A	473	67	0.2447	0.0486	0.3433	8.49e-04	3ehs:A, 3eht:A, 3n93:B, 3n93:A, 3n95:C, 3n95:D, 3n95:A, 3n95:B, 3n96:C, 3n96:D, 3n96:B
21	3n94:A	466	48	0.1596	0.0322	0.3125	0.002
22	8e3x:R	362	45	0.1596	0.0414	0.3333	0.004	6m1i:A, 6p9y:R
23	6lpb:R	331	48	0.1596	0.0453	0.3125	0.005
24	8x1w:A	439	55	0.1596	0.0342	0.2727	0.007	8x3e:A
25	7vqx:R	361	68	0.1702	0.0443	0.2353	0.044	7wbj:R
26	2jnd:A	79	52	0.1702	0.2025	0.3077	0.056
27	8j80:B	288	41	0.1489	0.0486	0.3415	0.073	8j7u:A, 8j7u:B, 8j7w:A, 8j7w:B, 8j7y:A, 8j7y:B
28	8e3y:R	372	51	0.1489	0.0376	0.2745	0.16	8e3z:R, 6vn7:R
29	3a9b:A	374	74	0.2021	0.0508	0.2568	1.8	3abx:A, 3vof:A
30	2e4h:A	74	48	0.2234	0.2838	0.4375	2.4
31	3ctp:A	266	35	0.1064	0.0376	0.2857	4.8	3ctp:B
32	6enz:A	487	23	0.0851	0.0164	0.3478	6.3	6enz:B
33	8pk0:l	72	29	0.1064	0.1389	0.3448	7.2
34	6wzg:R	379	54	0.1489	0.0369	0.2593	7.7	7d3s:R, 6wi9:R
35	6gsd:A	364	25	0.0851	0.0220	0.3200	8.7	5mlh:A, 5mlm:A, 5mlr:A
36	5ogx:A	333	15	0.0851	0.0240	0.5333	9.9

[Back]