IPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLK
The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ah0:w | 443 | 72 | 1.0000 | 0.1625 | 1.0000 | 2.13e-53 | 6ahd:w, 8ch6:J, 8h6e:2F, 8h6j:2F, 8h6k:2F, 8h6l:2F, 7qtt:J, 5z56:w, 5z57:w, 5z58:w |
2 | 8i0p:w | 434 | 72 | 1.0000 | 0.1659 | 1.0000 | 7.66e-53 | 7abh:4, 7abi:4, 7evo:C, 8hk1:C, 8i0r:w, 8i0s:w, 8i0t:w, 8i0u:w, 7onb:N, 7q3l:9, 7q4o:9, 7q4p:9, 6qx9:A3, 8r08:9, 8rm5:9, 7vpx:C, 6y50:9 |
3 | 6ff7:9 | 432 | 72 | 1.0000 | 0.1667 | 1.0000 | 7.76e-53 | |
4 | 6g90:T | 462 | 72 | 0.5000 | 0.0779 | 0.5000 | 1.50e-23 | 7dco:u, 4dgw:A, 5nrl:T, 5zwm:u |
5 | 7lo5:A | 1016 | 37 | 0.1667 | 0.0118 | 0.3243 | 4.0 | 7lo5:B, 7lo5:C, 7lo5:D, 7lvv:A, 7lvv:B, 7lvv:C, 7lvv:D |
6 | 3emr:A | 279 | 55 | 0.1667 | 0.0430 | 0.2182 | 4.3 | |
7 | 3jb9:Y | 261 | 38 | 0.1944 | 0.0536 | 0.3684 | 4.5 | |
8 | 2dte:A | 255 | 23 | 0.1111 | 0.0314 | 0.3478 | 4.8 | 2dte:B, 2dtx:A, 2dtx:B |
9 | 5evy:X | 411 | 21 | 0.1250 | 0.0219 | 0.4286 | 6.5 | |
10 | 8i0w:Y | 204 | 16 | 0.1111 | 0.0392 | 0.5000 | 7.1 | 5yzg:Y |
11 | 6zym:u | 157 | 16 | 0.1111 | 0.0510 | 0.5000 | 9.3 |