IPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTW
The query sequence (length=41) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2hap:C | 76 | 41 | 0.9756 | 0.5263 | 0.9756 | 9.94e-26 | 2hap:D, 1hwt:C, 1hwt:D, 1hwt:G, 1hwt:H, 1pyc:A, 1qp9:A, 1qp9:B, 1qp9:C, 1qp9:D |
2 | 6gys:B | 579 | 30 | 0.3415 | 0.0242 | 0.4667 | 1.57e-04 | 6f07:B, 6gyp:B, 6gys:C, 6gys:J, 6gys:I, 6gyu:B, 7k7g:M, 8ow1:CE |
3 | 1aw6:A | 43 | 29 | 0.3171 | 0.3023 | 0.4483 | 0.010 | |
4 | 3coq:A | 89 | 26 | 0.2927 | 0.1348 | 0.4615 | 0.020 | 3coq:B, 1d66:A, 1d66:B, 7uik:T, 7uik:U, 7uio:GA, 7uio:GB |
5 | 1pyi:A | 88 | 27 | 0.2927 | 0.1364 | 0.4444 | 0.091 | 1pyi:B |
6 | 1ajy:A | 71 | 38 | 0.3415 | 0.1972 | 0.3684 | 0.17 | 1ajy:B, 1zme:C, 1zme:D |
7 | 1cld:A | 33 | 27 | 0.2927 | 0.3636 | 0.4444 | 0.28 | |
8 | 2csh:A | 110 | 27 | 0.2683 | 0.1000 | 0.4074 | 2.6 | |
9 | 8i9r:Cg | 233 | 35 | 0.2683 | 0.0472 | 0.3143 | 2.9 | 8i9t:Cg |
10 | 6dgd:A | 704 | 19 | 0.2195 | 0.0128 | 0.4737 | 4.0 | 6dgd:B, 4nl4:H |
11 | 8fak:H | 643 | 19 | 0.2195 | 0.0140 | 0.4737 | 4.2 | 2d7g:A, 2d7g:B, 2d7g:C, 2d7g:D, 2d7h:A, 6dcr:A, 2dwl:A, 2dwl:B, 2dwl:C, 2dwl:D, 2dwm:A, 2dwm:C, 2dwm:D, 2dwn:A, 2dwn:C |
12 | 6dcr:B | 600 | 19 | 0.2195 | 0.0150 | 0.4737 | 4.3 | |
13 | 4nl8:E | 571 | 19 | 0.2195 | 0.0158 | 0.4737 | 4.5 | 4nl8:B |
14 | 4nl8:A | 549 | 19 | 0.2195 | 0.0164 | 0.4737 | 5.0 | |
15 | 1kea:A | 217 | 25 | 0.2195 | 0.0415 | 0.3600 | 5.3 | |
16 | 1dot:A | 686 | 20 | 0.2195 | 0.0131 | 0.4500 | 6.1 | 1gv8:A, 1gvc:A, 1ovb:A |
17 | 2cuq:A | 80 | 26 | 0.2195 | 0.1125 | 0.3462 | 6.8 | |
18 | 2dkc:A | 536 | 15 | 0.2195 | 0.0168 | 0.6000 | 6.8 | 2dkc:B, 2dkd:A, 2dkd:B |
19 | 6sei:A | 276 | 30 | 0.2439 | 0.0362 | 0.3333 | 7.9 | 6sei:C |
20 | 4xo4:A | 870 | 18 | 0.1463 | 0.0069 | 0.3333 | 8.1 | 3b2p:A, 3b2x:A, 3b34:A, 3b37:A, 3b3b:A, 2dq6:A, 2dqm:A, 6g8b:A, 2hpo:A, 2hpt:A, 3ked:A, 5mfr:A, 5mfs:A, 5mft:A, 3puu:A, 4q4e:A, 4q4i:A, 3qjx:A, 4xmt:A, 4xmu:A, 4xmv:A, 4xmw:A, 4xmx:A, 4xmz:A, 4xn1:A, 4xn2:A, 4xn4:A, 4xn5:A, 4xn7:A, 4xn8:A, 4xn9:A, 4xna:A, 4xnb:A, 4xnd:A, 4xo3:A, 4xo5:A, 5yo1:A, 5yq1:A, 5yq2:A, 5yqb:A, 2zxg:A |
21 | 6seh:C | 252 | 30 | 0.2439 | 0.0397 | 0.3333 | 8.2 | 6seh:A |
22 | 6o19:A | 59 | 25 | 0.2927 | 0.2034 | 0.4800 | 9.1 | 6e33:A |