IPKEMLRAQTNVILLNVLKQGDNGIIKQVKEASNGEMELNEATLYTIFDRLEQDGIISRLTEIGHENMRLAFESWSRVDK
IIENLEAN
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7q34:D | 88 | 88 | 1.0000 | 1.0000 | 1.0000 | 3.49e-60 | |
2 | 3f8f:A | 114 | 104 | 0.9773 | 0.7544 | 0.8269 | 1.13e-52 | 6do0:A, 6do0:B, 3f8c:A, 3f8f:B, 6fuu:A, 7q34:A, 7q34:B, 7q34:C, 7qz6:A, 7qz6:B, 7qz7:A, 7qz7:B, 7qz8:A, 7qz8:B, 6r1l:A, 6vwe:A, 6vwe:B, 7xuq:A, 8zf1:A |
3 | 4lrj:A | 160 | 46 | 0.2159 | 0.1187 | 0.4130 | 0.38 | 4lrj:B |
4 | 5zi8:A | 104 | 59 | 0.1932 | 0.1635 | 0.2881 | 1.1 | 7wh4:A, 7wh4:B, 5zhv:A, 5zhv:B, 5zi8:B |
5 | 1hiz:A | 375 | 68 | 0.2159 | 0.0507 | 0.2794 | 2.1 | 3mmd:A, 4prw:A, 4pud:A, 4pue:A, 1r85:A, 1r86:A, 1r87:A |
6 | 2eis:A | 121 | 32 | 0.1364 | 0.0992 | 0.3750 | 3.3 | 2eis:B |
7 | 4ine:A | 431 | 60 | 0.1818 | 0.0371 | 0.2667 | 3.6 | 4ine:B |
8 | 1tn4:A | 157 | 34 | 0.1591 | 0.0892 | 0.4118 | 3.7 | 1tcf:A, 2tn4:A |
9 | 8tg3:A | 187 | 22 | 0.1023 | 0.0481 | 0.4091 | 6.1 | 8tg4:A |
10 | 3owo:A | 382 | 43 | 0.1705 | 0.0393 | 0.3488 | 6.4 | 3owo:B, 3owo:C, 3owo:D, 3ox4:A, 3ox4:B, 3ox4:C, 3ox4:D |
11 | 1z9c:C | 138 | 24 | 0.1023 | 0.0652 | 0.3750 | 9.8 | 1z9c:A, 1z9c:B, 1z9c:D, 1z9c:E, 1z9c:F |