IPGQGLNSLRKNVVELPDSDYDLDKLVNVYPMTPGLIDQLRPEPVIARSNPQLDNLLKSYEYRIGVGDVLMVTVWDHPEL
TTPAGQYRSASDTGNWVNSDGTIFYPYIGKVQVAGKTVSQVRQDITSRLTTYIESPQVDVSIAAFRSQKVYVTGEVANSG
KQAITNIPLTVMDAINAAGGLAADADWRNVVLTHNGKDTKISLYALMQKGDLTQNHLLYHGDILFIPSNDDLKVFVMGEV
GKQSTLKMDRSGMTLAEALGNAEGISQEMSDATGIFVVRQLKGDRTGKIADIYQLNAQDASAMVLGTEFQLCPYDIVYVT
TA
The query sequence (length=322) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2w8h:A | 322 | 322 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2w8h:B, 2w8h:C, 2w8h:D, 2w8h:E, 2w8h:F, 2w8h:G, 2w8h:H |
2 | 2ig6:A | 143 | 99 | 0.0683 | 0.1538 | 0.2222 | 0.18 | 2ig6:B |
3 | 5hq4:A | 662 | 76 | 0.0528 | 0.0257 | 0.2237 | 2.1 | 5hqa:A, 5hqb:A, 5hqc:A |
4 | 1frw:A | 185 | 53 | 0.0497 | 0.0865 | 0.3019 | 2.1 | |
5 | 6ori:A | 381 | 138 | 0.1087 | 0.0919 | 0.2536 | 3.0 | |
6 | 5nrl:J | 800 | 49 | 0.0559 | 0.0225 | 0.3673 | 3.6 | 5gan:J, 5gap:J |
7 | 3iwk:H | 497 | 65 | 0.0590 | 0.0382 | 0.2923 | 4.7 | 3iwk:A, 3iwk:B, 3iwk:C, 3iwk:D, 3iwk:E, 3iwk:F, 3iwk:G, 3iwk:I, 3iwk:J, 3iwk:K, 3iwk:L |
8 | 8shj:A | 334 | 100 | 0.0839 | 0.0808 | 0.2700 | 8.1 | 8shj:B, 8t55:A, 8t55:B |
9 | 7sqc:1B | 1660 | 92 | 0.0745 | 0.0145 | 0.2609 | 9.1 | |
10 | 7sqc:1A | 1639 | 92 | 0.0745 | 0.0146 | 0.2609 | 9.2 | |
11 | 7sqc:1C | 1700 | 92 | 0.0745 | 0.0141 | 0.2609 | 9.3 | 7sqc:1D |