BioLiP Library

>protein
IPATVAAVKNPSSKIIYDEHNHERFPPGDPSKRAFAYFVLTGGRFVYASLIRLLVLKFVLSMSASKDVLALAS

The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8e73:E	74	73	1.0000	0.9865	1.0000	1.31e-48	8e73:Q
2	8bpx:AD	196	73	0.8219	0.3061	0.8219	2.25e-40	8bel:D, 8bel:N, 8bpx:BD, 8bq5:AD, 8bq5:BD, 8bq6:AD, 8bq6:BD
3	8ab7:P	186	42	0.2192	0.0860	0.3810	0.046	8ab7:E, 8ab8:P, 8ab9:P, 8aba:P, 8abb:P, 8abe:P, 8abf:P, 8abg:P, 8abh:P, 8abi:P, 8abj:P, 8abk:P, 8abm:P, 8ac3:P, 8ac4:P, 8ac5:P
4	3cwb:E	196	42	0.2055	0.0765	0.3571	0.066	3cwb:R, 3h1h:E, 3h1h:R, 3h1i:R, 3h1i:E, 3h1j:R, 3h1j:E, 3h1k:E, 3h1k:R, 3h1l:E, 3h1l:R, 3l70:E, 3l70:R, 3l71:E, 3l71:R, 3l72:E, 3l72:R, 3l73:E, 3l73:R, 3l74:E, 3l74:R, 3l75:E, 3l75:R, 3tgu:E, 3tgu:R, 4u3f:E, 4u3f:R
5	3cx5:P	185	40	0.1918	0.0757	0.3500	0.073	3cx5:E, 3cxh:P, 3cxh:E, 8e7s:C, 8e7s:c, 8ec0:C, 8ec0:c, 1ezv:E, 6giq:E, 6giq:P, 6hu9:E, 6hu9:P, 2ibz:E, 1kb9:E, 1kyo:E, 1kyo:P, 1p84:E, 4pd4:E, 6t0b:E, 6t0b:P, 6t15:E, 6t15:P, 6ymx:E, 6ymx:P
6	2a06:E	196	42	0.2192	0.0816	0.3810	0.084	2a06:R, 1bcc:E, 2bcc:E, 3bcc:E, 1be3:E, 1bgy:Q, 4d6t:R, 4d6u:R, 7dkf:Q1, 2fyu:E, 5gpn:E, 5gpn:Q, 5gup:2, 5gup:4, 6haw:E, 8iog:C, 8iog:c, 5j4z:AE, 5j4z:AP, 5j7y:AE, 5j7y:AP, 5j8k:AE, 5j8k:AP, 5klv:E, 1l0l:E, 1l0n:E, 5luf:q, 6nhg:E, 5nmi:E, 1ntk:E, 1ntm:E, 1ntz:E, 1nu1:E, 7o37:E, 7o37:P, 7o3c:E, 7o3c:P, 7o3h:E, 7o3h:P, 5okd:E, 8p65:E, 8p65:R, 1pp9:R, 1pp9:E, 1ppj:R, 1ppj:E, 8pw5:E, 8pw5:P, 8pw6:E, 8pw6:P, 8pw7:E, 8pw7:P, 6q9e:f1, 6q9e:f2, 6qbx:f1, 6qbx:f2, 6qc2:f1, 6qc2:f2, 6qc3:f1, 6qc3:f2, 6qc4:f1, 6qc4:f2, 7r3v:E, 1rie:A, 1sqb:E, 1sqp:E, 1sqq:E, 1sqv:E, 1sqx:E, 7tay:E, 7tz6:E, 7tz6:R, 8ugd:3E, 8ugd:3R, 8uge:3E, 8uge:3R, 8ugf:3E, 8ugf:3R, 8ugg:3E, 8ugg:3R, 8ugh:3E, 8ugh:3R, 8ugi:3E, 8ugi:3R, 8ugj:3E, 8ugj:3R, 8ugk:3E, 8ugk:3R, 8ugn:3E, 8ugn:3R, 8ugr:3E, 8ugr:3R, 8ugr:6E, 8ugr:6R, 5xte:C, 5xte:P, 5xth:AC, 5xth:AP, 5xti:AC, 5xti:AP, 6xvf:E, 2ybb:e, 2ybb:E, 6zfs:E, 6zft:E, 6zfu:E
7	7rja:C	181	40	0.2055	0.0829	0.3750	0.90	7rja:M, 7rjb:E, 7rjc:E, 7rjd:E, 7rje:C, 7rje:M
8	3sks:A	544	37	0.1644	0.0221	0.3243	1.4
9	8u4j:B	600	37	0.1918	0.0233	0.3784	1.5
10	3la3:A	198	24	0.1644	0.0606	0.5000	1.7	8h3v:X, 8h3v:Y, 8h40:X, 8h40:Y, 3la2:A, 3la2:B, 3la3:B
11	3lxd:A	409	27	0.1233	0.0220	0.3333	5.1
12	2h1n:A	566	26	0.1233	0.0159	0.3462	9.5	2h1j:A, 2h1j:B, 2h1n:B
13	2bog:X	280	36	0.1781	0.0464	0.3611	9.7	2bod:X, 2bof:X

[Back]