INPLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRIS
The query sequence (length=48) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1mt1:E | 50 | 48 | 1.0000 | 0.9600 | 1.0000 | 5.94e-29 | 1n13:E, 2qqc:E, 2qqd:D |
2 | 2qqd:C | 159 | 46 | 0.9375 | 0.2830 | 0.9783 | 3.67e-26 | 1mt1:A, 1mt1:F, 1mt1:B, 1mt1:C, 1mt1:G, 1mt1:J, 1mt1:H, 1mt1:K, 1n13:B, 1n13:C, 1n13:D, 1n13:A, 1n13:F, 1n13:H, 1n13:K, 1n13:G, 1n13:J, 1n13:I, 1n13:L, 2qqc:B, 2qqc:C, 2qqc:A, 2qqc:F, 2qqc:D, 2qqc:G, 2qqc:J, 2qqc:I, 2qqc:L, 2qqc:H, 2qqc:K, 2qqd:A, 2qqd:E, 2qqd:B |
3 | 8w8e:Z | 360 | 24 | 0.2292 | 0.0306 | 0.4583 | 0.87 | 8w8f:Z |
4 | 5oik:Z | 488 | 24 | 0.2292 | 0.0225 | 0.4583 | 0.87 | 6gml:Z, 8p4f:Z, 8rbx:Z, 7ycx:j |
5 | 1fsu:A | 475 | 22 | 0.2083 | 0.0211 | 0.4545 | 1.4 | |
6 | 3pgb:A | 740 | 38 | 0.3125 | 0.0203 | 0.3947 | 1.8 | |
7 | 7dbe:B | 332 | 24 | 0.2083 | 0.0301 | 0.4167 | 6.9 | 7dbe:A, 7dbe:C, 7dbe:D, 7wud:B, 7wud:A, 7wud:C, 7wud:D |
8 | 4g89:A | 233 | 35 | 0.3125 | 0.0644 | 0.4286 | 7.6 | 4g89:B |
9 | 1qz9:A | 404 | 28 | 0.2292 | 0.0272 | 0.3929 | 7.8 | |
10 | 1w7c:A | 737 | 22 | 0.2292 | 0.0149 | 0.5000 | 9.5 | 1n9e:A, 1n9e:B, 1n9e:C, 1n9e:D, 1rky:A |