INLLDLNRQQMREFFKDLGEKPFRADQVMKWMYHYCCDNFDEMTDINKVLRGKLKEVAEIRAPEVVEEQRSSDGTIKWAI
AVGDQRVETVYIPEDDRATLAVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIVGAAKVTGQRPITNVVMMG
MGEPLLNLNNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVPALDKLGDMIDVALAISLHAPNDEIRDEIVPINKKYNIETF
LAAVRRYLEKSNANQGRVTIEYVMLDHVNDGTEHAHQLAELLKDTPCKINLIPWNPFPGAPYGRSSNSRIDRFSKVLMSY
GFTTIVRKTRGDDIDAACGQLAGDVIDRTKRTLR
The query sequence (length=354) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5hr7:A | 360 | 354 | 1.0000 | 0.9833 | 1.0000 | 0.0 | 5hr6:A, 5hr6:B, 5hr7:B, 4pl1:B, 4pl1:A, 4pl2:B, 4pl2:A, 3rf9:A, 3rf9:B, 3rfa:A, 3rfa:B |
2 | 6fz6:A | 341 | 347 | 0.3955 | 0.4106 | 0.4035 | 6.91e-83 | 6fz6:B |
3 | 3c8f:A | 245 | 109 | 0.0904 | 0.1306 | 0.2936 | 7.94e-04 | 3cb8:A, 8fo0:A, 8fol:A, 8fsi:A |
4 | 7rhw:A | 437 | 154 | 0.0989 | 0.0801 | 0.2273 | 0.065 | 7rhv:A, 7rhv:B, 7rhw:B, 7ri0:A, 7ri0:B |
5 | 4gie:A | 288 | 77 | 0.0565 | 0.0694 | 0.2597 | 3.1 | 4fzi:A, 4fzi:B |
6 | 3h41:A | 305 | 47 | 0.0508 | 0.0590 | 0.3830 | 4.1 | |
7 | 6ofr:A | 758 | 127 | 0.0876 | 0.0409 | 0.2441 | 5.7 | |
8 | 3pm9:A | 465 | 79 | 0.0650 | 0.0495 | 0.2911 | 5.9 | 3pm9:B, 3pm9:C, 3pm9:D, 3pm9:E, 3pm9:F |
9 | 3o75:A | 270 | 74 | 0.0650 | 0.0852 | 0.3108 | 6.0 | 3o75:B |