BioLiP

>protein
INGVYYNEISRDLDISSSTQCLRFLKETVIPSLANNGNNSTSIQYHGISKNDNIKKSVNKLDKQINMADRSLGLQQVVCI
FSYGPHIQKMLSILEIFKKGYIKNNKKIYQWNKLTSFDIKREGRNELQEERLKVPILVTLVSDSEIIDLNLHSFTKQ

The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6w6v:F	158	157	1.0000	0.9937	1.0000	1.16e-113	6agb:F, 6ah3:F, 7c79:F, 7c7a:F, 3iab:A
2	7tve:D	445	41	0.0828	0.0292	0.3171	2.3
3	8p5e:3	649	50	0.1019	0.0247	0.3200	2.7	8kg6:3, 8kg8:3, 8kg9:3, 8p62:3, 8p63:3, 7pt6:3, 7pt6:C, 7pt7:3, 7qhs:3, 7v3u:3, 7v3u:C, 7v3v:3, 7v3v:C, 7w8g:3, 7w8g:C, 7z13:3, 7z13:b
4	3c0o:A	450	65	0.1146	0.0400	0.2769	3.0	3c0o:B
5	3lki:B	322	49	0.1146	0.0559	0.3673	3.1
6	2q2a:A	241	75	0.1083	0.0705	0.2267	4.2	2pvu:A, 2q2a:B, 2q2a:C, 2q2a:D, 2q2c:A, 2q2c:B, 2q2c:C, 2q2c:D
7	7pt7:C	633	36	0.0828	0.0205	0.3611	4.6
8	8w7m:3	619	36	0.0828	0.0210	0.3611	5.0	8b9a:3, 8b9b:3, 8b9c:3, 7pmk:3, 6skl:3, 8xgc:3
9	6hv9:3	558	36	0.0828	0.0233	0.3611	5.8
10	5v8f:3	654	36	0.0828	0.0199	0.3611	6.0	5bk4:B, 5bk4:3, 6eyc:3, 6f0l:3, 6f0l:B, 3ja8:3, 7p30:3, 7p30:B, 7p5z:3, 7p5z:B, 6ptn:j, 6ptn:3, 6pto:i, 6pto:3, 6rqc:3, 6sko:3, 6u0m:3, 5u8s:3, 5u8t:3
11	4otu:B	182	49	0.0828	0.0714	0.2653	7.0	5xlu:B, 5y8x:B, 5y9b:B
12	5swc:A	223	27	0.0446	0.0314	0.2593	7.1	5swc:B, 5swc:C, 5swc:D, 5swc:E, 5swc:F

[Back]