INAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQ
AEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSG
The query sequence (length=140) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pyd:C | 154 | 143 | 1.0000 | 0.9091 | 0.9790 | 2.48e-98 | 4pya:A, 4pyd:A, 4pyd:B, 4pyd:E, 4pyd:D, 4pyd:F |
2 | 3jqj:B | 149 | 139 | 0.5357 | 0.5034 | 0.5396 | 1.36e-41 | 3jqj:A, 3jqj:C, 3jqj:D, 3jqj:E, 3jqj:F, 3jqj:G, 3jqj:H, 3jqj:K, 3jqj:I, 3jqj:J, 3jqj:L, 3jqk:A, 3jqm:A, 3jqm:B, 3jqm:E, 3jqm:C, 3jqm:G, 3jqm:D, 3jqm:F, 3jqm:H, 3jqm:I |
3 | 8jez:A | 513 | 30 | 0.1143 | 0.0312 | 0.5333 | 0.16 | 8jew:A, 8jf1:A, 7ytw:A, 7ytw:B |
4 | 4aso:A | 93 | 40 | 0.1071 | 0.1613 | 0.3750 | 0.43 | 4aso:B, 4aso:D, 4aso:E, 4aso:F, 4aso:G, 4aso:H, 4aso:I, 4aso:K, 4aso:J, 4aso:L, 4aso:M, 4aso:N, 4aso:O, 4aso:P, 4ass:E, 4ass:F, 4ass:G, 4ass:H |
5 | 5b3u:B | 317 | 109 | 0.2071 | 0.0915 | 0.2661 | 1.8 | 5b3v:B, 5b3v:A, 5b3v:C, 5b3v:D |
6 | 8y6o:X | 131 | 62 | 0.1214 | 0.1298 | 0.2742 | 4.9 | |
7 | 3kvs:A | 161 | 51 | 0.1143 | 0.0994 | 0.3137 | 9.7 | 3brp:A |