IMASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVYISTVFKILDGLGIDIVSAQTSDTETNGW
The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pu4:D | 78 | 78 | 1.0000 | 1.0000 | 1.0000 | 9.80e-53 | 4pu3:D, 4pu3:C, 4pu4:C |
2 | 1y9q:A | 178 | 48 | 0.2692 | 0.1180 | 0.4375 | 4.57e-04 | |
3 | 8tac:B | 66 | 48 | 0.2051 | 0.2424 | 0.3333 | 0.14 | |
4 | 5jub:A | 298 | 46 | 0.2179 | 0.0570 | 0.3696 | 0.37 | 5jub:B |
5 | 6hua:A | 296 | 46 | 0.2179 | 0.0574 | 0.3696 | 0.38 | 6hua:B |
6 | 8ahx:A | 189 | 55 | 0.1795 | 0.0741 | 0.2545 | 0.77 | 8rb8:A, 8rb9:A, 8rbm:A, 8rbq:A |
7 | 3cro:L | 66 | 61 | 0.2308 | 0.2727 | 0.2951 | 2.8 | 3cro:R |
8 | 5wp4:A | 485 | 48 | 0.1795 | 0.0289 | 0.2917 | 5.5 | |
9 | 7ksf:A | 742 | 21 | 0.1538 | 0.0162 | 0.5714 | 7.5 | |
10 | 4j1x:C | 195 | 34 | 0.1538 | 0.0615 | 0.3529 | 7.5 | 2bnm:A, 2bnm:B, 2bnn:A, 2bnn:B, 2bno:A, 2bno:B, 4j1w:A, 4j1w:B, 4j1w:C, 4j1x:A, 4j1x:B, 3scf:A, 3scf:B, 3scf:C, 3scg:A, 3scg:B, 3scg:C, 3sch:A, 3sch:B, 1zz7:A, 1zz7:B, 1zz8:A, 1zz8:B, 1zz8:C, 1zz9:A, 1zz9:B, 1zz9:C, 1zzb:A, 1zzb:B, 1zzc:A, 1zzc:B |