IMASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVYISTVFKILDGLGIDIVSAGWY
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pu4:D | 78 | 68 | 0.9577 | 0.8718 | 1.0000 | 1.25e-43 | 4pu3:D, 4pu3:C, 4pu4:C |
2 | 1y9q:A | 178 | 48 | 0.2958 | 0.1180 | 0.4375 | 3.29e-04 | |
3 | 8tac:B | 66 | 48 | 0.2254 | 0.2424 | 0.3333 | 0.082 | |
4 | 5jub:A | 298 | 46 | 0.2394 | 0.0570 | 0.3696 | 0.26 | 5jub:B |
5 | 6hua:A | 296 | 46 | 0.2394 | 0.0574 | 0.3696 | 0.27 | 6hua:B |
6 | 8ahx:A | 189 | 55 | 0.1972 | 0.0741 | 0.2545 | 0.71 | 8rb8:A, 8rb9:A, 8rbm:A, 8rbq:A |
7 | 3cro:L | 66 | 58 | 0.2394 | 0.2576 | 0.2931 | 1.9 | 3cro:R |
8 | 5wp4:A | 485 | 62 | 0.2394 | 0.0351 | 0.2742 | 3.1 | |
9 | 6cmz:A | 462 | 46 | 0.2394 | 0.0368 | 0.3696 | 3.6 | 6cmz:B, 6cmz:C, 6cmz:D |
10 | 4j1x:C | 195 | 34 | 0.1690 | 0.0615 | 0.3529 | 5.4 | 2bnm:A, 2bnm:B, 2bnn:A, 2bnn:B, 2bno:A, 2bno:B, 4j1w:A, 4j1w:B, 4j1w:C, 4j1x:A, 4j1x:B, 3scf:A, 3scf:B, 3scf:C, 3scg:A, 3scg:B, 3scg:C, 3sch:A, 3sch:B, 1zz7:A, 1zz7:B, 1zz8:A, 1zz8:B, 1zz8:C, 1zz9:A, 1zz9:B, 1zz9:C, 1zzb:A, 1zzb:B, 1zzc:A, 1zzc:B |
11 | 7ksf:A | 742 | 21 | 0.1690 | 0.0162 | 0.5714 | 5.4 | |
12 | 8agq:A | 213 | 25 | 0.1268 | 0.0423 | 0.3600 | 9.9 | 5f07:A |