>protein
ILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPG
QITPVHDHRVWCLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANI
GAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
The query sequence (length=195) is searched through a non-redundant set of database sequences
protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
4wvz:D |
203 |
195 |
1.0000 |
0.9606 |
1.0000 |
2.17e-144 |
4tlf:A, 4tlf:B, 4tlf:C, 4tlf:D, 3uss:A, 3uss:B, 4wvz:A, 4wvz:B, 4wvz:C |
2 |
7kov:B |
194 |
194 |
0.6923 |
0.6959 |
0.6959 |
2.76e-92 |
7kov:A, 7kov:C, 7kov:D, 6xb9:A, 6xb9:B, 6xb9:C, 6xb9:D, 6xb9:E, 6xb9:F, 6xb9:G, 6xb9:H, 6xb9:I, 6xb9:J, 6xb9:K, 6xb9:L |
3 |
4qma:A |
192 |
191 |
0.6256 |
0.6354 |
0.6387 |
8.51e-86 |
|
4 |
6bgf:A |
188 |
109 |
0.1385 |
0.1436 |
0.2477 |
4.19e-05 |
2atf:A, 2b5h:A, 6bgm:A, 6bpr:A, 6bps:A, 6bpt:A, 6bpu:A, 6bpv:A, 6bpw:A, 6bpx:A, 6cdh:A, 6cdn:A, 6e87:A, 5efu:A, 3eln:A, 5ezw:A, 2gh2:A, 5i0r:A, 5i0s:A, 5i0t:A, 5i0u:A, 2ic1:A, 4ieo:A, 4iep:A, 4ieq:A, 4ier:A, 4ies:A, 4iet:A, 4ieu:A, 4iev:A, 4iew:A, 4iex:A, 4iey:A, 4iez:A, 4jtn:A, 4jto:A, 4kwj:A, 4kwk:A, 4kwl:A, 6n42:A, 6n43:A, 4pix:A, 4piy:A, 4piz:A, 4pjy:A, 6u1m:A, 6u4l:A, 6u4s:A, 6u4v:A, 4ubg:A, 4ubh:A, 8vl9:D, 8vlb:D, 4xet:A, 4xez:A, 4xf0:A, 4xf1:A, 4xf3:A, 4xf4:A, 4xf9:A, 4xfa:A, 4xfb:A, 4xfc:A, 4xff:A, 4xfg:A, 4xfh:A, 4xfi:A, 4ysf:A, 4yyo:A, 4z82:A |
5 |
7cxz:A |
245 |
61 |
0.0872 |
0.0694 |
0.2787 |
2.0 |
|
6 |
8p7b:B |
455 |
44 |
0.0923 |
0.0396 |
0.4091 |
2.3 |
8p7b:D, 8p7c:B, 8p7c:D, 8p7d:B, 4rqe:C, 4rqf:A |
7 |
2e5y:A |
133 |
51 |
0.0923 |
0.1353 |
0.3529 |
8.0 |
2e5y:B, 7xkq:H |
8 |
8h8i:A |
431 |
22 |
0.0513 |
0.0232 |
0.4545 |
8.1 |
8hbt:A |
[Back]