BioLiP

>protein
ILIDVPLYQADTNDYLDENGQVIFNLSTLIKEKYHLIGKYDVEDPFIDDSELLWEEKDGFFVYF

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ghm:L	64	64	1.0000	1.0000	1.0000	2.56e-41
2	8ghm:F	43	64	0.6719	1.0000	0.6719	9.20e-21
3	4a04:B	190	52	0.2812	0.0947	0.3462	0.69	4a04:A
4	6hvg:A	1278	32	0.2031	0.0102	0.4062	1.4	6hvg:B, 6syq:A, 6syq:B, 6szi:A, 6szi:B, 6t16:B, 6t16:A, 6t18:A, 6t18:B, 6t1p:A, 6t1p:B
5	6zj3:LY	134	39	0.2031	0.0970	0.3333	1.7
6	4ox3:A	214	33	0.2031	0.0607	0.3939	2.7
7	4v3p:LM	140	39	0.2031	0.0929	0.3333	3.2	8azw:e, 8b2l:e3, 8ip8:GA, 8ipa:GA, 8ipb:GA, 8jiv:CV, 7qiw:X, 7qiz:X, 4v7e:CV
8	6m0r:A	750	19	0.1406	0.0120	0.4737	3.8	7tao:A
9	8ceh:g	183	30	0.1562	0.0546	0.3333	3.9	8cg8:g, 8civ:g, 8cmj:g, 7osm:uS3
10	5iji:A	227	34	0.1562	0.0441	0.2941	5.3	5jef:A, 5jef:B, 5jgp:A
11	4ba0:A	781	32	0.1562	0.0128	0.3125	6.5	4b9y:A, 4b9z:A, 5i23:A, 5i24:A, 5npb:A, 5npc:A, 5npd:A, 5npe:A, 7p4c:AAA, 7p4d:AAA, 8rw3:C, 8rw3:A, 8rw3:B
12	6zu5:LB0	363	66	0.3125	0.0551	0.3030	6.7
13	5an9:E	136	39	0.1719	0.0809	0.2821	7.4	5anb:E, 5anc:E, 6qkl:E
14	8g27:I	720	25	0.2344	0.0208	0.6000	8.1	8g27:C, 8g27:D, 8g2j:C, 8g2j:D, 8g2j:I, 6wlb:A, 6wlb:C, 6wlb:B
15	3mbh:A	290	31	0.2031	0.0448	0.4194	8.8	3mbh:B, 3mbh:C, 3mbh:D, 3mbh:E, 3mbh:F, 3mbj:A
16	4ng4:B	389	46	0.2031	0.0334	0.2826	8.9	4ng4:A, 4ng4:C

[Back]