IKSLFAVIIGGSVGCTLRWLLSTKFNSLFPNLPPGTLVVNLLAGLIIGTALAYFLRQPHLDPFWKLMITTGLCGGLSTYS
TFSVEVFALLQAGNYIWALTSVLVHVIGSLIMTALGFFIITILF
The query sequence (length=124) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5a43:B | 126 | 124 | 0.9839 | 0.9683 | 0.9839 | 2.59e-83 | 5a43:A, 6b24:A, 6b24:B, 6b2a:A, 6b2a:B, 6b2b:A, 6b2b:B, 6b2d:A, 6b2d:B, 6bx4:A, 6bx4:B, 6bx5:A, 6bx5:B, 5kbn:A, 5kbn:B, 7kk8:A, 7kk8:B, 7kk9:A, 7kk9:B, 7kka:A, 7kka:B, 7kkb:A, 7kkb:B, 7kkr:A, 7kkr:B, 5kom:A, 5kom:B |
2 | 6bqo:B | 128 | 122 | 0.3629 | 0.3516 | 0.3689 | 7.18e-15 | 6bqo:A, 5nkq:A, 5nkq:B, 5nkq:C |
3 | 8k9e:C | 449 | 36 | 0.1371 | 0.0379 | 0.4722 | 5.1 | 8k9f:C, 8x2j:C |