IKSLFAVIIGGSVGCTLRWLLSTKFNSLFPNLPPGTLVVNLLAGLIIGTALAYFLRQPHLDPFWKLMITTGLCGGLSTFA
TFSVEVFALLQAGNYIWALTSVLVHVIGSLIMTALGFFIITILFA
The query sequence (length=125) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5a43:B | 126 | 125 | 0.9840 | 0.9762 | 0.9840 | 6.84e-84 | 5a43:A, 6b24:A, 6b24:B, 6b2a:A, 6b2a:B, 6b2b:A, 6b2b:B, 6b2d:A, 6b2d:B, 6bx4:A, 6bx4:B, 6bx5:A, 6bx5:B, 5kbn:A, 5kbn:B, 7kk8:A, 7kk8:B, 7kk9:A, 7kk9:B, 7kka:A, 7kka:B, 7kkb:A, 7kkb:B, 7kkr:A, 7kkr:B, 5kom:A, 5kom:B |
2 | 6bqo:B | 128 | 122 | 0.3600 | 0.3516 | 0.3689 | 8.43e-15 | 6bqo:A, 5nkq:A, 5nkq:B, 5nkq:C |
3 | 2r4v:A | 226 | 86 | 0.1920 | 0.1062 | 0.2791 | 9.3 | 2per:A |
4 | 8sun:B | 743 | 31 | 0.0960 | 0.0162 | 0.3871 | 9.8 | 8b8k:A, 8b8k:B, 8b8m:A, 6qp6:A, 6qp6:B, 8sur:B, 8tag:B, 8tai:B, 8tal:B |