IKQKLETQFTCLFCNHDNSVVCTLDKKNSIGLLECKKCGQRFQAPINSLSQPIDIYSDWIDACE
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8he5:M | 64 | 64 | 0.9531 | 0.9531 | 0.9531 | 2.63e-40 | 6ir9:M, 6j4w:M, 6j4x:M, 6j4y:M, 6j51:M, 8jh2:M, 7wbv:M, 7wbx:M, 7xn7:M, 5xog:M, 7xse:M, 7xsx:M, 7xsz:M, 7xt7:M, 7xtd:M, 7xti:M |
2 | 1wii:A | 85 | 60 | 0.5156 | 0.3882 | 0.5500 | 9.80e-22 | 8b3d:M, 8b3f:M |
3 | 5xy3:p | 89 | 48 | 0.1875 | 0.1348 | 0.2500 | 0.046 | |
4 | 7olc:Lp | 91 | 45 | 0.2031 | 0.1429 | 0.2889 | 0.14 | 8ia0:Lp, 7old:Lp, 8oo0:Lp, 8pv1:Lp, 8pv2:Lp, 8pv3:Lp, 8pv4:Lp, 8pv5:Lp, 8pv6:Lp, 8pv7:Lp, 8pv8:Lp, 8pvk:Lp, 8pvl:Lp, 7r81:r1, 7z3n:Lp, 7z3o:Lp |
5 | 4xsv:A | 306 | 38 | 0.2031 | 0.0425 | 0.3421 | 2.2 | 3elb:A |
6 | 4v4n:Ai | 78 | 42 | 0.1875 | 0.1538 | 0.2857 | 2.7 | 4v6u:Bi |
7 | 8smc:C | 1084 | 67 | 0.2812 | 0.0166 | 0.2687 | 2.9 | |
8 | 8u7h:C | 1111 | 67 | 0.2812 | 0.0162 | 0.2687 | 2.9 | |
9 | 9ezy:B | 657 | 19 | 0.1250 | 0.0122 | 0.4211 | 3.2 | |
10 | 2xig:C | 150 | 20 | 0.1406 | 0.0600 | 0.4500 | 4.2 | 2xig:A, 2xig:B, 2xig:D |
11 | 7e5a:B | 471 | 46 | 0.1562 | 0.0212 | 0.2174 | 4.2 | 7e5a:A |
12 | 6zu5:LT0 | 160 | 30 | 0.1719 | 0.0688 | 0.3667 | 5.0 | |
13 | 3io3:A | 230 | 42 | 0.2031 | 0.0565 | 0.3095 | 5.5 | |
14 | 6raz:7 | 601 | 16 | 0.1250 | 0.0133 | 0.5000 | 7.5 | 6ray:7 |
15 | 6rax:7 | 632 | 16 | 0.1250 | 0.0127 | 0.5000 | 8.3 | 6raw:7 |