IISRRESLRALVALSGIAAIVTYGLKGAKDADLPITKGPQTTGENGKGGSV
The query sequence (length=51) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7d0j:H | 100 | 51 | 1.0000 | 0.5100 | 1.0000 | 1.84e-30 | 7dz7:H, 7dz8:H, 8h2u:H, 6ijo:H |
2 | 7yca:H | 96 | 45 | 0.4314 | 0.2292 | 0.4889 | 3.79e-08 | |
3 | 6sl5:H | 92 | 51 | 0.5686 | 0.3152 | 0.5686 | 6.92e-08 | |
4 | 6igz:H | 88 | 48 | 0.4510 | 0.2614 | 0.4792 | 5.12e-05 | |
5 | 6zzx:H | 94 | 50 | 0.4510 | 0.2447 | 0.4600 | 3.87e-04 | 6zzy:H |
6 | 7kb1:A | 428 | 29 | 0.2549 | 0.0304 | 0.4483 | 3.0 | 7kb1:B, 7kb1:C, 7kb1:D |
7 | 7oi6:y | 331 | 44 | 0.3333 | 0.0514 | 0.3864 | 4.1 | 8pk0:t |
8 | 3v97:B | 641 | 34 | 0.2157 | 0.0172 | 0.3235 | 4.7 | 3v8v:B |
9 | 3v97:A | 667 | 34 | 0.2157 | 0.0165 | 0.3235 | 5.0 | 3v8v:A |
10 | 7cyy:C | 497 | 43 | 0.2941 | 0.0302 | 0.3488 | 5.0 | 7cx7:A, 7cx7:B, 7cx7:C, 7cx7:D, 7cx7:E, 7cx7:F, 7cyy:A, 7cyy:B, 7cyy:D, 7cyy:E, 7cyy:F |
11 | 1bli:A | 481 | 33 | 0.2941 | 0.0312 | 0.4545 | 8.2 | 1ob0:A, 6toy:A, 6toz:A, 6tp0:A, 6tp1:A, 6tp2:A |
12 | 1lh0:A | 213 | 35 | 0.2157 | 0.0516 | 0.3143 | 9.9 | 1lh0:B, 1opr:A, 1oro:A, 1sto:A |