IILSNKPNIRGIKNVVEDIKYRNQLIGRDGRLFAGLIATRISGIAIGFLLAVLLVGVPAMMSILGVI
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8q3v:F | 67 | 67 | 1.0000 | 1.0000 | 1.0000 | 7.43e-41 | 8q3v:V, 8q3v:f, 8q54:V, 8q54:F, 8q54:f |
2 | 8q3v:A | 61 | 48 | 0.2090 | 0.2295 | 0.2917 | 0.017 | 8q3v:a, 8q3v:Q, 8q54:A, 8q54:a, 8q54:Q |
3 | 3puo:A | 292 | 48 | 0.2388 | 0.0548 | 0.3333 | 1.0 | 3puo:B, 3s8h:A, 3s8h:B |
4 | 4jrn:A | 349 | 32 | 0.2090 | 0.0401 | 0.4375 | 2.8 | |
5 | 4dnr:A | 1031 | 33 | 0.1791 | 0.0116 | 0.3636 | 5.6 | 3k0i:A, 7kf6:A, 7kf6:B, 7kf6:C, 7kf7:B, 7kf8:B, 7kf8:C, 3t53:A |
6 | 6pqc:A | 252 | 21 | 0.1194 | 0.0317 | 0.3810 | 6.6 | 7kep:A, 7keq:A, 7ker:A, 7lnq:A, 7lnr:A, 7mea:A, 7meb:A, 7mec:A, 7med:A, 7mee:A, 7mef:A, 7meg:A, 7meh:A |
7 | 7p5o:B | 558 | 38 | 0.1642 | 0.0197 | 0.2895 | 8.9 | 7p5o:A |
8 | 8ayh:B | 951 | 26 | 0.1493 | 0.0105 | 0.3846 | 9.3 | 3frp:A, 3hrz:A, 3hs0:A, 3hs0:F |