Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
IIFAANYLGSTQLLNVRMMQAQEAVSRIKMAQKLATEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMA
RRRYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINP

The query sequence (length=122) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 1x11:A 135 130 0.9508 0.8593 0.8923 1.06e-75 1aqc:B, 1x11:B
2 3sv1:A 163 139 0.9262 0.6933 0.8129 1.64e-74 1aqc:A, 3sv1:B, 3sv1:C
3 6itu:A 146 133 0.3279 0.2740 0.3008 1.34e-11
4 8ym2:A 149 127 0.2951 0.2416 0.2835 9.94e-05
5 1shc:A 195 86 0.1803 0.1128 0.2558 1.24e-04 2l1c:A
6 5iy6:U 170 72 0.1475 0.1059 0.2500 0.70 5iy7:U, 5iy8:U, 5iya:U, 5iyb:U, 5iyc:U, 6o9l:U, 1tfi:A
7 1eg4:A 260 47 0.1311 0.0615 0.3404 2.6
8 5y6p:dy 303 65 0.1475 0.0594 0.2769 4.0 5y6p:dz
9 3hoi:A 193 66 0.1803 0.1140 0.3333 7.3
10 3mzs:A 470 50 0.1230 0.0319 0.3000 9.9 3mzs:B, 3mzs:C, 3mzs:D

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218