BioLiP

>protein
IHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKK

The query sequence (length=42) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3wuv:Q	62	42	1.0000	0.6774	1.0000	7.96e-25	3e1r:A, 3e1r:B, 3wut:A, 3wut:B, 3wut:D, 3wut:E, 3wut:G, 3wut:H, 3wut:J, 3wut:K, 3wuu:A, 3wuu:B, 3wuu:D, 3wuu:E, 3wuu:J, 3wuu:K, 3wuu:G, 3wuu:H, 3wuv:A, 3wuv:B, 3wuv:D, 3wuv:E, 3wuv:G, 3wuv:H, 3wuv:J, 3wuv:K, 3wuv:M, 3wuv:N, 3wuv:P
2	2wys:B	516	32	0.2857	0.0233	0.3750	0.28	2w5f:A, 2w5f:B, 2wys:A, 2wze:A, 2wze:B
3	8pv6:CR	516	15	0.1667	0.0136	0.4667	2.6	8pv8:CR
4	6vlz:Q	240	34	0.3095	0.0542	0.3824	2.9	7a5f:Q3, 7a5g:Q3, 7a5h:Q, 7a5i:Q3, 7a5j:Q, 7a5k:Q3, 8any:Q, 6i9r:Q, 3j7y:Q, 3j9m:Q, 8k2a:LS, 8k2b:LS, 7l08:Q, 7l20:Q, 6nu2:Q, 6nu3:Q, 7o9k:Q, 7o9m:Q, 7odr:Q, 7ods:Q, 7odt:Q, 7of0:Q, 7of2:Q, 7of3:Q, 7of4:Q, 7of5:Q, 7of6:Q, 7of7:Q, 7og4:XQ, 7oi7:Q, 7oi8:Q, 7oi9:Q, 7oia:Q, 7oib:Q, 7oic:Q, 7oid:Q, 7oie:Q, 8oir:BX, 8oit:BX, 5ool:Q, 5oom:Q, 7pd3:Q, 8pk0:Q, 7po4:Q, 7qh6:Q, 7qh7:Q, 7qi4:Q, 7qi5:Q, 7qi6:Q, 8qsj:Q, 8qu1:Q, 8qu5:Q, 6vmi:Q, 8xt0:LS, 8xt1:LS, 8xt2:LS, 8xt3:LS, 6zm5:Q, 6zm6:Q, 6zs9:XQ, 6zsa:XQ, 6zsb:XQ, 6zsc:XQ, 6zsd:XQ, 6zse:XQ, 6zsg:XQ
5	8pv4:CR	390	18	0.2143	0.0231	0.5000	2.9
6	8wgh:H	90	33	0.2619	0.1222	0.3333	3.4
7	6l2c:A	402	38	0.2857	0.0299	0.3158	5.3	6l2c:B, 6l2c:C, 6l2c:D
8	4qhz:C	240	22	0.2143	0.0375	0.4091	5.7	4qhz:A, 4qhz:B, 4qhz:D
9	2x5d:D	380	27	0.3095	0.0342	0.4815	5.9	2x5d:A
10	6jon:A	280	26	0.1905	0.0286	0.3077	6.7	6jop:A, 6joq:A, 6k9a:A, 7rr3:A, 7rr4:A
11	7pub:Cr	267	25	0.2143	0.0337	0.3600	7.1	6hiv:Cr, 6hiw:Cr, 6hiy:Cr

[Back]