BioLiP

>protein
IFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEE
PTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAA

The query sequence (length=159) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6edt:M	159	159	1.0000	1.0000	1.0000	1.87e-113	6ee8:M, 6eec:M, 7kif:M, 7kin:M, 6vvx:M, 6vvy:M, 6vvz:M, 6vw0:M
2	8hvr:H	158	157	0.8491	0.8544	0.8599	9.81e-96	8jke:H
3	7kim:M	135	159	0.8491	1.0000	0.8491	7.04e-86
4	4xls:M	162	154	0.2516	0.2469	0.2597	1.62e-13	4xlr:M, 4xlr:N, 4xls:N
5	6m6a:M	459	47	0.1006	0.0349	0.3404	0.012	6m6b:M
6	6acx:A	1175	59	0.1258	0.0170	0.3390	0.012	6acx:B
7	6rxt:CN	226	109	0.1698	0.1195	0.2477	0.20	5oql:e, 6rxu:CN, 6rxv:CN, 6rxx:CN, 6rxy:CN, 6rxz:CN
8	8p5d:SP0	117	44	0.1006	0.1368	0.3636	0.23	8p60:SP0, 8p60:RP0, 7qca:SP0
9	8yyr:A	496	61	0.1321	0.0423	0.3443	1.2	7dq5:A, 7dq5:B, 7dq6:A, 7dq6:B, 6m01:A, 8yyq:A
10	8hkx:S19P	115	52	0.1006	0.1391	0.3077	2.7	8hky:S19P, 8hkz:S19P, 8hl1:S19P, 8hl2:S19P, 8hl3:S19P, 8hl4:S19P, 8hl5:S19P, 8wkp:S19P, 8wq2:S19P, 8wq4:S19P
11	2vfk:A	205	60	0.1132	0.0878	0.3000	4.1	2vfl:A
12	5jj2:A	211	33	0.0943	0.0711	0.4545	5.6
13	5m0p:A	424	79	0.1447	0.0542	0.2911	9.0	4l40:A, 4l54:A, 5m0n:A, 5m0o:A, 5m0o:C, 5m0p:B
14	5e26:B	362	26	0.0755	0.0331	0.4615	9.3	5e26:A, 5e26:C, 5e26:D

[Back]