IFEEAASFRSYQSKLGRDGRASAATATLTTKIRIFVPATNSPELRWELTLFALDVIRSPSAAESMKVGAAFTLISMYSER
PGALIRSLLNDPDIEAVIIDVGSMVNGIPVMERRGDKAQEEMEGLMRILKTARDSSKGKTPFVDSRAYGLRITDMSTLVS
AVITIEAQIWILIAKAVTAPDTAEESETRRWAKYVQQKRVNPFFALTQQWLTEMRNLLSQSLSVRKFMVEILIEVKKGGS
AKGRAVEIISDIGNYVEETGMAGFFATIRFGLETRYPALALNEFQSDLNTIKSLMLLYREIGPRAPYMVLLEESIQTKFA
PGGYPLLWSFAMGVATTIDRSMGALNINRGYLEPMYFRLGQKSARH
The query sequence (length=366) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7nt5:B | 395 | 366 | 1.0000 | 0.9266 | 1.0000 | 0.0 | 8c4h:C, 8c4h:D, 8c4h:E, 8c4h:F, 8c4h:G, 8c4h:H, 8c4h:I, 8c4h:J, 8c4h:K, 8c4h:L, 8c4h:M, 8c4h:N, 8c4h:A, 8c4h:B, 8c4h:a, 8c4h:b, 8c4h:c, 8c4h:d, 8c4h:e, 8c4h:f, 8c4h:g, 8c4h:h, 8c4h:i, 8c4h:j, 8c4h:k, 8c4h:l, 8c4h:m, 8c4h:n, 8cbw:A, 7nt5:A, 7nt5:C, 7nt5:D, 7nt5:E, 7nt5:F, 7nt5:G, 7nt5:H, 7nt5:I, 7nt5:J, 7nt5:K, 7nt5:L, 7nt5:M, 7nt6:H, 7nt6:J, 7nt6:K, 7nt6:L, 7nt6:M, 7nt6:N, 7nt6:O, 7nt6:C, 7nt6:D, 7nt6:E, 7nt6:F, 7nt6:G |
2 | 7oi3:E | 394 | 302 | 0.3552 | 0.3299 | 0.4305 | 1.09e-85 | |
3 | 6h5q:B | 381 | 334 | 0.3716 | 0.3570 | 0.4072 | 1.66e-83 | 6h5s:C, 4uft:B |
4 | 6jc3:A | 391 | 363 | 0.3142 | 0.2941 | 0.3168 | 9.22e-62 | |
5 | 4xjn:A | 395 | 341 | 0.3033 | 0.2810 | 0.3255 | 4.35e-56 | 5wkn:A, 5wkn:B, 4xjn:B, 4xjn:C, 4xjn:D, 4xjn:E, 4xjn:F, 4xjn:G, 4xjn:H, 4xjn:I, 4xjn:J, 4xjn:K, 4xjn:L, 4xjn:M |
6 | 7ozr:A | 403 | 353 | 0.2951 | 0.2680 | 0.3059 | 3.08e-53 | 7ewq:A, 7exa:A |
7 | 7ev8:A | 328 | 198 | 0.1995 | 0.2226 | 0.3687 | 1.32e-38 | |
8 | 6m7d:A | 412 | 216 | 0.1885 | 0.1675 | 0.3194 | 1.27e-33 | |
9 | 5z9w:A | 388 | 76 | 0.0519 | 0.0490 | 0.2500 | 0.12 | 6nut:A, 4ypi:C, 4ypi:A, 4ypi:B, 4ypi:D |
10 | 7f1m:A | 394 | 111 | 0.0738 | 0.0685 | 0.2432 | 0.25 | 7f1m:B, 5f5o:A, 5f5o:C, 5f5o:E, 5xsq:A, 5xsq:C, 5xsq:E |
11 | 3cnl:A | 233 | 87 | 0.0656 | 0.1030 | 0.2759 | 0.30 | 3cnn:A, 3cno:A |
12 | 7ypw:A | 388 | 68 | 0.0601 | 0.0567 | 0.3235 | 0.46 | 7yr8:A |
13 | 8tj5:T | 801 | 57 | 0.0437 | 0.0200 | 0.2807 | 7.7 | 8tj5:R |
14 | 7d1b:A | 302 | 101 | 0.0574 | 0.0695 | 0.2079 | 8.4 | |
15 | 7w61:A | 249 | 50 | 0.0492 | 0.0723 | 0.3600 | 9.5 |