BioLiP

>protein
IERPEDFLKDKENAIQWEKKEAERVEKNLDTLEKEALELYKKDSEQISNYSQTRQYFYDYQIESNPREKEYKNLRNAISK
NKIDKPINVYYFESPEKFAFNKEIRTENQNEISLEKFNELKETIQDKLFKQDGFKDVSLYEPGNGDEKPTPLLIHLKLPK
NTGMLPYINSNDVKTLIEQDYSIKIDKIVRIVIEGKQYIKAEASIVNSLDFKDDVSKGDLWGKENYSDWSNKLTPNELAD
VNDYMRGGYTAINNYLISNGPLNNPNPELDSKVNNIENALKLTPIPSNLIVYRRSGPQEFGLTLTSPEYDFNKIENIDAF
KEKWEGKVITYPNFISTSIGSVNMSAFAKRKIILRINIPKDSPGAYLSAIPGYAGEYEVLLNHGSKFKINKVDSYKDGTV
TKLILDATLIN

The query sequence (length=411) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4h03:A	414	411	1.0000	0.9928	1.0000	0.0	3buz:A, 1giq:A, 1giq:B, 1gir:A, 4h0t:A, 4h0v:A, 4h0x:A, 4h0y:A
2	6x6x:A	417	410	0.8564	0.8441	0.8585	0.0	2wn6:A, 2wn7:A, 6x6r:A, 6x6r:B, 6x6v:A, 6x6v:B, 6x6v:C, 6x6v:D, 6x6x:B
3	5wtz:A	420	416	0.4477	0.4381	0.4423	1.46e-112	5h04:A, 5wu0:A
4	1qs2:A	401	349	0.2774	0.2843	0.3266	2.79e-46
5	1qs2:A	401	198	0.1071	0.1097	0.2222	0.002
6	4fxq:A	445	210	0.1533	0.1416	0.3000	1.91e-18	4fk7:A, 4fxq:B
7	4fxq:A	445	146	0.1046	0.0966	0.2945	0.034	4fk7:A, 4fxq:B
8	5dzq:O	184	169	0.1265	0.2826	0.3077	4.11e-16	5dzq:A
9	5dzq:O	184	185	0.1168	0.2609	0.2595	3.21e-04	5dzq:A
10	5bwm:B	205	187	0.1314	0.2634	0.2888	2.42e-11	4xsh:B
11	5bwm:B	205	212	0.1241	0.2488	0.2406	0.022	4xsh:B
12	1gzf:B	211	202	0.1290	0.2512	0.2624	1.67e-10	2a9k:B, 2c8a:A, 2c8a:B, 2c8a:C, 2c8a:D, 2c8c:A, 2c8c:D, 2c8c:B, 2c8c:C, 2c8f:E, 2c8h:A, 2c8h:B, 1gzf:A, 1gzf:C, 1gzf:D, 1uzi:A, 1uzi:B
13	1ojz:A	212	193	0.1046	0.2028	0.2228	0.005
14	4xzj:A	222	197	0.1144	0.2117	0.2386	0.010	4xzk:A, 4yc0:A
15	1vrg:A	515	238	0.1387	0.1107	0.2395	0.060	1vrg:B, 1vrg:C, 1vrg:D, 1vrg:E, 1vrg:F
16	1j70:A	512	58	0.0389	0.0312	0.2759	3.0	1g8f:A, 1g8g:A, 1g8g:B, 1g8h:A, 1g8h:B, 1j70:B, 1j70:C, 1jec:A, 1jed:A, 1jed:B, 1jee:A, 1jee:B, 1r6x:A
17	3zp5:A	92	68	0.0462	0.2065	0.2794	5.3
18	1xim:A	392	103	0.0608	0.0638	0.2427	6.7	1xim:B, 1xim:C, 1xim:D, 1xin:A, 1xin:B, 1xin:C, 1xin:D, 2xim:A, 2xim:B, 2xim:C, 2xim:D, 2xin:A, 2xin:B, 2xin:C, 2xin:D, 3xim:A, 3xim:B, 3xim:C, 3xim:D, 4xim:A, 4xim:B, 4xim:C, 4xim:D, 5xim:A, 5xim:B, 5xim:C, 5xim:D, 5xin:A, 5xin:B, 5xin:C, 5xin:D, 6xim:A, 6xim:B, 6xim:C, 6xim:D, 8xim:A, 8xim:B, 8xim:C, 8xim:D, 9xim:A, 9xim:B, 9xim:C, 9xim:D
19	7sgl:D	406	109	0.0560	0.0567	0.2110	9.0	7abs:A, 7af1:A, 7afs:A, 7afu:A, 7agi:A, 7apv:A, 6tt5:AAA, 6wnl:A, 6wnl:B, 6wo0:A

[Back]